Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4094
Gene name
LocationContig_212:125..1213
Strand-
Gene length (bp)1088
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05637 Glyco_transf_34 galactosyl transferase GMA12/MNN10 family 1.3E-65 63 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13640|YGWH_SCHPO Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi048 PE=3 SV=2 81 294 1.0E-39
sp|O94622|YBKD_SCHPO Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1289.13c PE=3 SV=1 73 294 1.0E-29
sp|Q09174|GMA12_SCHPO Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gma12 PE=1 SV=1 81 286 7.0E-27
sp|P46985|MNN11_YEAST Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN11 PE=1 SV=2 58 294 1.0E-23
sp|P50108|MNN10_YEAST Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN10 PE=1 SV=1 87 300 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13640|YGWH_SCHPO Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi048 PE=3 SV=2 81 294 1.0E-39
sp|O94622|YBKD_SCHPO Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1289.13c PE=3 SV=1 73 294 1.0E-29
sp|Q09174|GMA12_SCHPO Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gma12 PE=1 SV=1 81 286 7.0E-27
sp|P46985|MNN11_YEAST Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN11 PE=1 SV=2 58 294 1.0E-23
sp|P50108|MNN10_YEAST Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN10 PE=1 SV=1 87 300 4.0E-21
sp|Q09679|GMH1_SCHPO Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gmh1 PE=3 SV=1 65 285 5.0E-21
sp|Q09681|GMH2_SCHPO Probable alpha-1,2-galactosyltransferase gmh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gmh2 PE=3 SV=1 56 285 3.0E-20
sp|Q10359|GMH3_SCHPO Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gmh3 PE=3 SV=1 87 285 3.0E-19
sp|P78817|YFE6_SCHPO Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC637.06 PE=2 SV=2 68 300 2.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044425 membrane part No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 31 48 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4094
MHFAYPPRKSSNPPPFRPRSVPFLRRSRLKTVALVFLAFVAAAYLLLGSRKRSPYHERVPSGTPAVVLVTVVDPT
TWDNGYLKTVRENREKYAALHGYEAMVVKAYDYDTRGAPQSWAKVMALRHALSKYPDCKFIWYLDQNAYIMDPTK
SLEELVLEPKTLESLMIKDYPVVPPDSIIKTFSHLRGQDVDFIVSQDKESLVHTSVIVRNGEWAKFFVETWFDPL
YRSYNFQKAERHALEHIVQWHPTVLSKLALVPQRTFAAYLHPTRGDAYQQGDFVVISPDCTQTGAQSCETDLKPY
LPEWRRALGLS*
Coding >Hirsu2|4094
ATGCACTTCGCGTACCCTCCTCGCAAAAGCTCCAACCCGCCGCCTTTCCGGCCCAGGTCGGTCCCGTTTCTGCGA
AGGAGCCGGTTAAAAACGGTGGCCCTGGTCTTCCTGGCTTTCGTTGCGGCGGCCTACCTCCTGCTGGGATCGAGA
AAACGGAGCCCCTACCACGAACGTGTGCCGTCGGGCACTCCAGCGGTCGTCCTGGTGACGGTGGTCGACCCCACC
ACATGGGACAATGGCTACCTGAAAACGGTGCGCGAGAATCGCGAAAAATATGCGGCATTGCATGGCTACGAGGCG
ATGGTGGTCAAGGCCTACGACTACGACACGCGCGGCGCGCCTCAGTCGTGGGCCAAGGTCATGGCGCTGCGTCAT
GCGCTGTCCAAGTACCCCGACTGCAAGTTCATCTGGTATCTTGACCAGAACGCTTACATCATGGACCCGACCAAG
AGCCTGGAGGAGCTGGTGCTGGAGCCCAAGACGCTGGAGAGCCTGATGATCAAGGACTATCCCGTCGTCCCGCCG
GACAGCATCATCAAGACGTTTTCGCACCTGCGGGGGCAAGACGTCGATTTCATCGTCAGCCAAGACAAGGAGAGC
CTGGTGCACACGAGCGTCATCGTGCGGAACGGGGAATGGGCCAAGTTCTTCGTCGAGACCTGGTTCGATCCGCTC
TACCGGAGCTACAACTTTCAGAAAGCCGAGCGGCACGCACTGGAACACATTGTGCAATGGCATCCGACGGTGCTG
TCGAAGCTGGCCCTCGTGCCACAGCGGACCTTTGCCGCATACCTGCACCCGACTCGAGGCGACGCCTACCAGCAG
GGCGACTTTGTCGTCATCTCGCCCGACTGCACGCAGACGGGCGCGCAAAGCTGCGAAACGGATCTGAAGCCGTAT
CTGCCCGAGTGGAGGCGCGCGCTGGGACTGTCCTGA
Transcript >Hirsu2|4094
ATGCACTTCGCGTACCCTCCTCGCAAAAGCTCCAACCCGCCGCCTTTCCGGCCCAGGTCGGTCCCGTTTCTGCGA
AGGAGCCGGTTAAAAACGGTGGCCCTGGTCTTCCTGGCTTTCGTTGCGGCGGCCTACCTCCTGCTGGGATCGAGA
AAACGGAGCCCCTACCACGAACGTGTGCCGTCGGGCACTCCAGCGGTCGTCCTGGTGACGGTGGTCGACCCCACC
ACATGGGACAATGGCTACCTGAAAACGGTGCGCGAGAATCGCGAAAAATATGCGGCATTGCATGGCTACGAGGCG
ATGGTGGTCAAGGCCTACGACTACGACACGCGCGGCGCGCCTCAGTCGTGGGCCAAGGTCATGGCGCTGCGTCAT
GCGCTGTCCAAGTACCCCGACTGCAAGTTCATCTGGTATCTTGACCAGAACGCTTACATCATGGACCCGACCAAG
AGCCTGGAGGAGCTGGTGCTGGAGCCCAAGACGCTGGAGAGCCTGATGATCAAGGACTATCCCGTCGTCCCGCCG
GACAGCATCATCAAGACGTTTTCGCACCTGCGGGGGCAAGACGTCGATTTCATCGTCAGCCAAGACAAGGAGAGC
CTGGTGCACACGAGCGTCATCGTGCGGAACGGGGAATGGGCCAAGTTCTTCGTCGAGACCTGGTTCGATCCGCTC
TACCGGAGCTACAACTTTCAGAAAGCCGAGCGGCACGCACTGGAACACATTGTGCAATGGCATCCGACGGTGCTG
TCGAAGCTGGCCCTCGTGCCACAGCGGACCTTTGCCGCATACCTGCACCCGACTCGAGGCGACGCCTACCAGCAG
GGCGACTTTGTCGTCATCTCGCCCGACTGCACGCAGACGGGCGCGCAAAGCTGCGAAACGGATCTGAAGCCGTAT
CTGCCCGAGTGGAGGCGCGCGCTGGGACTGTCCTGA
Gene >Hirsu2|4094
ATGCACTTCGCGTACCCTCCTCGCAAAAGCTCCAACCCGCCGCCTTTCCGGCCCAGGTCGGTCCCGTTTCTGCGA
AGGAGCCGGTTAAAAACGGTGGCCCTGGTCTTCCTGGCTTTCGTTGCGGCGGCCTACCTCCTGCTGGGATCGAGA
AAACGGAGCCCCTACCACGAACGTGTGCCGTCGGGCACTCCAGCGGTCGTCCTGGTGACGGTGGTCGACCCCACC
ACATGGGACAATGGCTACCTGAAAACGGTGCGCGAGAATCGCGAAAAATATGCGGCATTGCATGGTCAGCACGCG
TTTTCCCGCTCCCCTGCCTGACCTTGGACGGGCTGGGAGGAGAGAGACTAACCGGCCATGTCCAGGCTACGAGGC
GATGGTGGTCAAGGCCTACGACTACGACACGCGCGGCGCGCCTCAGTCGTGGGCCAAGGTCATGGCGCTGCGTCA
TGCGCTGTCCAAGTACCCCGACTGCAAGTTCATCTGGTATCTTGACCAGAACGCTTACATCATGGACCCGACCAA
GAGCCTGGAGGAGCTGGTGCTGGAGCCCAAGACGCTGGAGAGCCTGATGATCAAGGACTATCCCGTCGTCCCGCC
GGACAGCATCATCAAGACGTTTTCGCACCTGCGGGGGCAAGACGTCGATTTCATCGTCAGCCAAGACAAGGAGAG
CCTGGTGCACACGAGCGTCATCGTGCGGAACGGGGAATGGGCCAAGTTCTTCGTCGAGACCTGGTTCGATCCGCT
CTACCGGAGCTACAACTTTCAGAAAGCCGAGCGGCACGCACTGGTACGTTCGACGACGGGCGGAGGCGGCCCGGG
AGAGGCGCGGCGCCGCACGGGAGGGGGCTCACAGGATAAAACAGGAACACATTGTGCAATGGCATCCGACGGTGC
TGTCGAAGCTGGCCCTCGTGCCACAGCGGACCTTTGCCGCATACCTGCACCCGACTCGAGGCGACGCCTACCAGC
AGGGCGACTTTGTCGTCATCTCGCCCGACTGCACGCAGACGGGCGCGCAAAGCTGCGAAACGGATCTGAAGCCGT
ATCTGCCCGAGTGGAGGCGCGCGCTGGGACTGTCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail