Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4087
Gene name
LocationContig_2114:78..1572
Strand+
Gene length (bp)1494
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01566 Nramp Natural resistance-associated macrophage protein 2.8E-86 13 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38925|SMF1_YEAST Manganese transporter SMF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF1 PE=1 SV=2 1 449 8.0E-162
sp|Q10177|PDT1_SCHPO Manganese transporter pdt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdt1 PE=1 SV=1 1 448 1.0E-142
sp|P38778|SMF2_YEAST Manganese transporter SMF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF2 PE=3 SV=1 1 449 7.0E-135
sp|Q12078|SMF3_YEAST Iron transporter SMF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF3 PE=1 SV=1 1 438 1.0E-123
sp|Q8ZSB0|MNTH_NOSS1 Divalent metal cation transporter MntH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mntH PE=3 SV=1 1 399 5.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38925|SMF1_YEAST Manganese transporter SMF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF1 PE=1 SV=2 1 449 8.0E-162
sp|Q10177|PDT1_SCHPO Manganese transporter pdt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdt1 PE=1 SV=1 1 448 1.0E-142
sp|P38778|SMF2_YEAST Manganese transporter SMF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF2 PE=3 SV=1 1 449 7.0E-135
sp|Q12078|SMF3_YEAST Iron transporter SMF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF3 PE=1 SV=1 1 438 1.0E-123
sp|Q8ZSB0|MNTH_NOSS1 Divalent metal cation transporter MntH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mntH PE=3 SV=1 1 399 5.0E-73
sp|Q8PKX1|MNTH_XANAC Divalent metal cation transporter MntH OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mntH PE=3 SV=1 1 399 7.0E-73
sp|Q98I99|MNTH_RHILO Divalent metal cation transporter MntH OS=Rhizobium loti (strain MAFF303099) GN=mntH PE=3 SV=1 1 399 5.0E-71
sp|Q8UEM1|MNTH_AGRFC Divalent metal cation transporter MntH OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mntH PE=3 SV=1 1 439 9.0E-70
sp|P65545|MNTH_BRUSU Divalent metal cation transporter MntH OS=Brucella suis biovar 1 (strain 1330) GN=mntH PE=3 SV=1 1 399 1.0E-69
sp|P65544|MNTH_BRUME Divalent metal cation transporter MntH OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mntH PE=3 SV=1 1 399 1.0E-69
sp|Q89K67|MNTH_BRADU Divalent metal cation transporter MntH OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mntH PE=3 SV=1 1 446 3.0E-69
sp|Q8P8R8|MNTH_XANCP Divalent metal cation transporter MntH OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mntH PE=3 SV=1 1 399 4.0E-68
sp|Q8Y773|MNTH_LISMO Divalent metal cation transporter MntH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntH PE=3 SV=1 1 399 6.0E-66
sp|B8DE85|MNTH_LISMH Divalent metal cation transporter MntH OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mntH PE=3 SV=1 1 399 6.0E-66
sp|Q71ZP6|MNTH_LISMF Divalent metal cation transporter MntH OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mntH PE=3 SV=1 1 399 6.0E-66
sp|C1L2Y0|MNTH_LISMC Divalent metal cation transporter MntH OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mntH PE=3 SV=1 1 399 6.0E-66
sp|A0AIM7|MNTH_LISW6 Divalent metal cation transporter MntH OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mntH PE=3 SV=1 1 399 1.0E-65
sp|Q92BT1|MNTH_LISIN Divalent metal cation transporter MntH OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntH PE=3 SV=1 1 399 2.0E-65
sp|Q7A166|MNTH_STAAW Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain MW2) GN=mntH PE=3 SV=1 1 399 3.0E-64
sp|Q6GAA9|MNTH_STAAS Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain MSSA476) GN=mntH PE=3 SV=1 1 399 3.0E-64
sp|Q99UZ7|MNTH_STAAN Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain N315) GN=mntH PE=1 SV=1 1 399 3.0E-64
sp|A6QFW1|MNTH_STAAE Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain Newman) GN=mntH PE=3 SV=1 1 399 3.0E-64
sp|Q5HGX9|MNTH_STAAC Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain COL) GN=mntH PE=3 SV=1 1 399 3.0E-64
sp|A5IRZ2|MNTH_STAA9 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain JH9) GN=mntH PE=3 SV=1 1 399 3.0E-64
sp|Q2G2G3|MNTH_STAA8 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain NCTC 8325) GN=mntH PE=3 SV=1 1 399 3.0E-64
sp|Q2FHX5|MNTH_STAA3 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain USA300) GN=mntH PE=3 SV=1 1 399 3.0E-64
sp|A6U0S3|MNTH_STAA2 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain JH1) GN=mntH PE=3 SV=1 1 399 3.0E-64
sp|Q5HQ64|MNTH_STAEQ Divalent metal cation transporter MntH OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mntH PE=3 SV=1 1 399 3.0E-64
sp|Q931T9|MNTH_STAAM Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mntH PE=3 SV=1 1 399 7.0E-64
sp|A7X111|MNTH_STAA1 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mntH PE=3 SV=1 1 399 7.0E-64
sp|Q8CPM6|MNTH_STAES Divalent metal cation transporter MntH OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mntH PE=3 SV=1 1 399 7.0E-64
sp|Q2YX69|MNTH_STAAB Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mntH PE=3 SV=1 1 399 1.0E-63
sp|B3W6P3|MNTH_LACCB Divalent metal cation transporter MntH OS=Lactobacillus casei (strain BL23) GN=mntH PE=3 SV=1 1 399 4.0E-61
sp|Q03D26|MNTH_LACC3 Divalent metal cation transporter MntH OS=Lactobacillus casei (strain ATCC 334) GN=mntH PE=3 SV=1 1 399 5.0E-61
sp|Q6GHY0|MNTH_STAAR Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain MRSA252) GN=mntH PE=3 SV=1 1 399 6.0E-60
sp|Q93V04|MNTH_LACBR Divalent metal cation transporter MntH OS=Lactobacillus brevis GN=mntH PE=2 SV=1 1 399 2.0E-59
sp|Q553K4|NRAM2_DICDI Natural resistance-associated macrophage protein 2 homolog OS=Dictyostelium discoideum GN=nramp2 PE=3 SV=1 1 399 4.0E-59
sp|Q49WM9|MNTH_STAS1 Divalent metal cation transporter MntH OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mntH PE=3 SV=1 1 399 3.0E-57
sp|Q03TH5|MNTH_LACBA Divalent metal cation transporter MntH OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mntH PE=3 SV=1 1 406 3.0E-56
sp|Q4L5B9|MNTH_STAHJ Divalent metal cation transporter MntH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mntH PE=3 SV=1 1 399 2.0E-55
sp|Q38UX8|MNTH_LACSS Divalent metal cation transporter MntH OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=mntH PE=3 SV=1 1 399 2.0E-55
sp|Q03DK0|MNTH_PEDPA Divalent metal cation transporter MntH OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mntH PE=3 SV=1 1 399 1.0E-54
sp|Q9SAH8|NRAM1_ARATH Metal transporter Nramp1 OS=Arabidopsis thaliana GN=NRAMP1 PE=1 SV=1 1 399 7.0E-53
sp|Q0B8F7|MNTH_BURCM Divalent metal cation transporter MntH OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mntH PE=3 SV=1 3 399 8.0E-53
sp|Q9S9N8|NRAM6_ARATH Metal transporter Nramp6 OS=Arabidopsis thaliana GN=NRAMP6 PE=2 SV=2 1 404 3.0E-52
sp|Q8XSF6|MNTH_RALSO Divalent metal cation transporter MntH OS=Ralstonia solanacearum (strain GMI1000) GN=mntH PE=3 SV=1 1 445 7.0E-52
sp|Q8GH68|MNTH_LACPL Divalent metal cation transporter MntH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mntH PE=3 SV=1 1 399 2.0E-51
sp|Q0D7E4|NRAM1_ORYSJ Metal transporter Nramp1 OS=Oryza sativa subsp. japonica GN=NRAMP1 PE=2 SV=1 1 399 2.0E-51
sp|Q653V6|NRAM3_ORYSJ Metal transporter Nramp3 OS=Oryza sativa subsp. japonica GN=NRAMP3 PE=2 SV=1 1 399 3.0E-51
sp|Q87EJ9|MNTH_XYLFT Divalent metal cation transporter MntH OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mntH PE=3 SV=1 1 446 5.0E-51
sp|Q9RPF2|MNTH2_PSEAE Divalent metal cation transporter MntH 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mntH2 PE=3 SV=2 1 399 4.0E-50
sp|Q9PEL3|MNTH_XYLFA Divalent metal cation transporter MntH OS=Xylella fastidiosa (strain 9a5c) GN=mntH PE=3 SV=1 1 446 6.0E-49
sp|Q8R7S2|MNTH_CALS4 Divalent metal cation transporter MntH OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mntH PE=3 SV=1 1 404 9.0E-49
sp|Q6ZG85|NRAT1_ORYSJ Metal transporter NRAT1 OS=Oryza sativa subsp. japonica GN=NRAT1 PE=2 SV=1 1 397 2.0E-48
sp|Q8H4H5|NRAM5_ORYSJ Metal transporter Nramp5 OS=Oryza sativa subsp. japonica GN=NRAMP5 PE=2 SV=1 1 399 2.0E-47
sp|Q9RPF3|MNTH1_PSEAE Divalent metal cation transporter MntH 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mntH1 PE=3 SV=2 1 445 1.0E-45
sp|Q0BW85|MNTH_GRABC Divalent metal cation transporter MntH OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mntH PE=3 SV=1 1 399 3.0E-45
sp|P96593|MNTH_BACSU Divalent metal cation transporter MntH OS=Bacillus subtilis (strain 168) GN=mntH PE=1 SV=1 3 399 5.0E-45
sp|Q869V1|NRAM1_DICDI Metal transporter nramp1 homolog OS=Dictyostelium discoideum GN=nramp1 PE=2 SV=1 1 399 8.0E-45
sp|A5G348|MNTH_ACICJ Divalent metal cation transporter MntH OS=Acidiphilium cryptum (strain JF-5) GN=mntH PE=3 SV=1 3 399 1.0E-44
sp|Q97TN5|MNTH_CLOAB Divalent metal cation transporter MntH OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mntH PE=3 SV=1 1 401 3.0E-43
sp|Q9RTP8|MNTH_DEIRA Divalent metal cation transporter MntH OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mntH PE=3 SV=1 1 399 5.0E-43
sp|P51027|NRAM1_CHICK Natural resistance-associated macrophage protein 1 OS=Gallus gallus GN=SLC11A1 PE=2 SV=1 1 394 3.0E-42
sp|Q0T2A8|MNTH_SHIF8 Divalent metal cation transporter MntH OS=Shigella flexneri serotype 5b (strain 8401) GN=mntH PE=3 SV=1 3 410 2.0E-41
sp|Q1QZ83|MNTH_CHRSD Divalent metal cation transporter MntH OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mntH PE=3 SV=1 3 399 9.0E-41
sp|P49283|MVL_DROME Protein Malvolio OS=Drosophila melanogaster GN=Mvl PE=2 SV=2 1 394 1.0E-40
sp|A1WR47|MNTH_VEREI Divalent metal cation transporter MntH OS=Verminephrobacter eiseniae (strain EF01-2) GN=mntH PE=3 SV=1 1 399 2.0E-40
sp|Q10Q65|NRAM2_ORYSJ Metal transporter Nramp2 OS=Oryza sativa subsp. japonica GN=NRAMP2 PE=2 SV=1 1 399 4.0E-40
sp|O54902|NRAM2_RAT Natural resistance-associated macrophage protein 2 OS=Rattus norvegicus GN=Slc11a2 PE=1 SV=1 1 394 1.0E-39
sp|B5XVU3|MNTH_KLEP3 Divalent metal cation transporter MntH OS=Klebsiella pneumoniae (strain 342) GN=mntH PE=3 SV=1 3 399 2.0E-39
sp|A6TC38|MNTH_KLEP7 Divalent metal cation transporter MntH OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mntH PE=3 SV=1 3 399 2.0E-39
sp|A8A2P6|MNTH_ECOHS Divalent metal cation transporter MntH OS=Escherichia coli O9:H4 (strain HS) GN=mntH PE=3 SV=1 3 410 3.0E-39
sp|A7MP48|MNTH_CROS8 Divalent metal cation transporter MntH OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mntH PE=3 SV=1 3 434 3.0E-39
sp|A7N307|MNTH_VIBCB Divalent metal cation transporter MntH OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mntH PE=3 SV=1 3 399 5.0E-39
sp|B7UGA0|MNTH_ECO27 Divalent metal cation transporter MntH OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|Q3YZE0|MNTH_SHISS Divalent metal cation transporter MntH OS=Shigella sonnei (strain Ss046) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|Q31Y80|MNTH_SHIBS Divalent metal cation transporter MntH OS=Shigella boydii serotype 4 (strain Sb227) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B2TWY8|MNTH_SHIB3 Divalent metal cation transporter MntH OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B7LL85|MNTH_ESCF3 Divalent metal cation transporter MntH OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|Q1R8X4|MNTH_ECOUT Divalent metal cation transporter MntH OS=Escherichia coli (strain UTI89 / UPEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B1LMI9|MNTH_ECOSM Divalent metal cation transporter MntH OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B6I6U2|MNTH_ECOSE Divalent metal cation transporter MntH OS=Escherichia coli (strain SE11) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B7N5Z2|MNTH_ECOLU Divalent metal cation transporter MntH OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|P0A769|MNTH_ECOLI Divalent metal cation transporter MntH OS=Escherichia coli (strain K12) GN=mntH PE=1 SV=1 3 410 5.0E-39
sp|B1IX71|MNTH_ECOLC Divalent metal cation transporter MntH OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|P0A770|MNTH_ECOL6 Divalent metal cation transporter MntH OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|Q0TF69|MNTH_ECOL5 Divalent metal cation transporter MntH OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|A1ADR7|MNTH_ECOK1 Divalent metal cation transporter MntH OS=Escherichia coli O1:K1 / APEC GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B1X9R3|MNTH_ECODH Divalent metal cation transporter MntH OS=Escherichia coli (strain K12 / DH10B) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|C4ZVS8|MNTH_ECOBW Divalent metal cation transporter MntH OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B7M6R1|MNTH_ECO8A Divalent metal cation transporter MntH OS=Escherichia coli O8 (strain IAI1) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B7MY49|MNTH_ECO81 Divalent metal cation transporter MntH OS=Escherichia coli O81 (strain ED1a) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B7NPS9|MNTH_ECO7I Divalent metal cation transporter MntH OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B5YZU5|MNTH_ECO5E Divalent metal cation transporter MntH OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|P0A771|MNTH_ECO57 Divalent metal cation transporter MntH OS=Escherichia coli O157:H7 GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B7LCE3|MNTH_ECO55 Divalent metal cation transporter MntH OS=Escherichia coli (strain 55989 / EAEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|B7MH51|MNTH_ECO45 Divalent metal cation transporter MntH OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|A7ZPK2|MNTH_ECO24 Divalent metal cation transporter MntH OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mntH PE=3 SV=1 3 410 5.0E-39
sp|Q9SNV9|NRAM3_ARATH Metal transporter Nramp3 OS=Arabidopsis thaliana GN=NRAMP3 PE=2 SV=2 1 399 6.0E-39
sp|B1JFZ6|MNTH_YERPY Divalent metal cation transporter MntH OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mntH PE=3 SV=1 3 399 6.0E-39
sp|Q668N2|MNTH_YERPS Divalent metal cation transporter MntH OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mntH PE=3 SV=1 3 399 6.0E-39
sp|A4TMF6|MNTH_YERPP Divalent metal cation transporter MntH OS=Yersinia pestis (strain Pestoides F) GN=mntH PE=3 SV=1 3 399 6.0E-39
sp|Q1CJV0|MNTH_YERPN Divalent metal cation transporter MntH OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mntH PE=3 SV=1 3 399 6.0E-39
sp|Q8ZCK2|MNTH_YERPE Divalent metal cation transporter MntH OS=Yersinia pestis GN=mntH PE=3 SV=1 3 399 6.0E-39
sp|B2K911|MNTH_YERPB Divalent metal cation transporter MntH OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mntH PE=3 SV=1 3 399 6.0E-39
sp|Q1C5Y6|MNTH_YERPA Divalent metal cation transporter MntH OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mntH PE=3 SV=1 3 399 6.0E-39
sp|A7FGC8|MNTH_YERP3 Divalent metal cation transporter MntH OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mntH PE=3 SV=1 3 399 6.0E-39
sp|A4WD10|MNTH_ENT38 Divalent metal cation transporter MntH OS=Enterobacter sp. (strain 638) GN=mntH PE=3 SV=1 3 445 6.0E-39
sp|P56436|NRAM1_CEREL Natural resistance-associated macrophage protein 1 OS=Cervus elaphus GN=SLC11A1 PE=2 SV=1 1 394 7.0E-39
sp|P49282|NRAM2_MOUSE Natural resistance-associated macrophage protein 2 OS=Mus musculus GN=Slc11a2 PE=1 SV=2 1 394 1.0E-38
sp|O77741|NRAM1_PIG Natural resistance-associated macrophage protein 1 OS=Sus scrofa GN=SLC11A1 PE=2 SV=1 1 394 1.0E-38
sp|P49279|NRAM1_HUMAN Natural resistance-associated macrophage protein 1 OS=Homo sapiens GN=SLC11A1 PE=2 SV=1 1 399 2.0E-38
sp|Q9FN18|NRAM4_ARATH Metal transporter Nramp4 OS=Arabidopsis thaliana GN=NRAMP4 PE=2 SV=1 1 399 3.0E-38
sp|Q32DF6|MNTH_SHIDS Divalent metal cation transporter MntH OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mntH PE=3 SV=1 3 410 4.0E-38
sp|A0KG66|MNTH_AERHH Divalent metal cation transporter MntH OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mntH PE=3 SV=1 3 358 4.0E-38
sp|P41251|NRAM1_MOUSE Natural resistance-associated macrophage protein 1 OS=Mus musculus GN=Slc11a1 PE=1 SV=2 1 394 4.0E-38
sp|Q27946|NRAM1_BUBBU Natural resistance-associated macrophage protein 1 OS=Bubalus bubalis GN=SLC11A1 PE=2 SV=1 1 394 5.0E-38
sp|P49280|NRAM1_SHEEP Natural resistance-associated macrophage protein 1 OS=Ovis aries GN=SLC11A1 PE=2 SV=2 1 394 6.0E-38
sp|Q9C6B2|NRAM2_ARATH Metal transporter Nramp2 OS=Arabidopsis thaliana GN=NRAMP2 PE=2 SV=1 1 399 7.0E-38
sp|A8ADJ8|MNTH_CITK8 Divalent metal cation transporter MntH OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mntH PE=3 SV=2 3 399 9.0E-38
sp|Q95102|NRAM1_BISBI Natural resistance-associated macrophage protein 1 OS=Bison bison GN=SLC11A1 PE=2 SV=1 1 394 1.0E-37
sp|Q9XT74|NRAM1_CANLF Natural resistance-associated macrophage protein 1 OS=Canis lupus familiaris GN=SLC11A1 PE=2 SV=2 1 429 2.0E-37
sp|Q492G8|MNTH_BLOPB Divalent metal cation transporter MntH OS=Blochmannia pennsylvanicus (strain BPEN) GN=mntH PE=3 SV=1 3 443 2.0E-37
sp|Q27981|NRAM1_BOVIN Natural resistance-associated macrophage protein 1 OS=Bos taurus GN=SLC11A1 PE=2 SV=1 1 394 2.0E-37
sp|Q9RPF4|MNTH_SALTY Divalent metal cation transporter MntH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mntH PE=1 SV=1 3 399 3.0E-37
sp|C0PZC8|MNTH_SALPC Divalent metal cation transporter MntH OS=Salmonella paratyphi C (strain RKS4594) GN=mntH PE=3 SV=1 3 399 3.0E-37
sp|Q57LU5|MNTH_SALCH Divalent metal cation transporter MntH OS=Salmonella choleraesuis (strain SC-B67) GN=mntH PE=3 SV=1 3 399 3.0E-37
sp|Q8Z4X5|MNTH_SALTI Divalent metal cation transporter MntH OS=Salmonella typhi GN=mntH PE=3 SV=1 3 399 3.0E-37
sp|B4TQE4|MNTH_SALSV Divalent metal cation transporter MntH OS=Salmonella schwarzengrund (strain CVM19633) GN=mntH PE=3 SV=1 3 399 3.0E-37
sp|B5BB80|MNTH_SALPK Divalent metal cation transporter MntH OS=Salmonella paratyphi A (strain AKU_12601) GN=mntH PE=3 SV=1 3 399 3.0E-37
sp|Q5PNF0|MNTH_SALPA Divalent metal cation transporter MntH OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mntH PE=3 SV=1 3 399 3.0E-37
sp|B5RCN6|MNTH_SALG2 Divalent metal cation transporter MntH OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mntH PE=3 SV=1 3 399 5.0E-37
sp|B5R3U1|MNTH_SALEP Divalent metal cation transporter MntH OS=Salmonella enteritidis PT4 (strain P125109) GN=mntH PE=3 SV=1 3 399 5.0E-37
sp|A1JLC3|MNTH_YERE8 Divalent metal cation transporter MntH OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mntH PE=3 SV=1 3 445 1.0E-36
sp|P49281|NRAM2_HUMAN Natural resistance-associated macrophage protein 2 OS=Homo sapiens GN=SLC11A2 PE=1 SV=2 1 439 1.0E-36
sp|P9WIZ5|MNTH_MYCTU Divalent metal cation transporter MntH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mntH PE=1 SV=1 3 439 6.0E-36
sp|P9WIZ4|MNTH_MYCTO Divalent metal cation transporter MntH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mntH PE=3 SV=1 3 439 6.0E-36
sp|C6D9J9|MNTH_PECCP Divalent metal cation transporter MntH OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mntH PE=3 SV=1 3 411 7.0E-36
sp|Q2QN30|NRAM6_ORYSJ Metal transporter Nramp6 OS=Oryza sativa subsp. japonica GN=NRAMP6 PE=2 SV=1 1 401 2.0E-35
sp|Q5QN13|NRAM4_ORYSJ Metal transporter Nramp4 OS=Oryza sativa subsp. japonica GN=NRAMP4 PE=2 SV=1 1 394 4.0E-35
sp|O69443|MNTH_MYCBO Divalent metal cation transporter MntH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mntH PE=3 SV=2 3 439 6.0E-35
sp|B2VDY7|MNTH_ERWT9 Divalent metal cation transporter MntH OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mntH PE=3 SV=1 3 438 4.0E-34
sp|Q9SN36|NRAM5_ARATH Metal transporter Nramp5 OS=Arabidopsis thaliana GN=NRAMP5 PE=2 SV=1 1 401 5.0E-33
sp|Q21434|NRAML_CAEEL NRAMP-like transporter smf-1 OS=Caenorhabditis elegans GN=smf-1 PE=3 SV=2 1 399 1.0E-32
sp|P70553|NRAM1_RAT Natural resistance-associated macrophage protein 1 OS=Rattus norvegicus GN=Slc11a1 PE=2 SV=3 25 394 2.0E-32
sp|Q50103|MNTH_MYCLE Divalent metal cation transporter MntH OS=Mycobacterium leprae (strain TN) GN=mntH PE=3 SV=2 3 409 6.0E-27
sp|Q9S814|EIN2_ARATH Ethylene-insensitive protein 2 OS=Arabidopsis thaliana GN=EIN2 PE=1 SV=1 1 402 2.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0016020 membrane Yes
GO:0008324 cation transmembrane transporter activity No
GO:0008150 biological_process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0006812 cation transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 66 88 22
3 98 120 22
4 133 155 22
5 178 200 22
6 254 276 22
7 302 324 22
8 345 362 17
9 372 394 22
10 425 447 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4087
MVAVAYIDPGNYATDIVAGSTYQFRLLFVVLVSNMFAILLQSLAIRLGTVTGLDLSSMCRAQLPRWLNWLLYALA
EVAIIATDLVEVIGMAIAINLLIPQLPMPAACALAFLDVMAILFFYRPDGTIRGLRLFEAFVSLLVLGVIVCFCI
QLSMIKGTSVGTVFRGYLPSKAIIESEGIYQACGILGATVMPHSLFLGSGLVQPRLKEYDAKQGLMPPSQGGLMS
SDGGVHSNAPYVPSYAAIKHSLKYSITELALSLFTFALFVNSAILVVAGASLYRNPDALGADIFGIHDLLAKSIS
PAVGTIFALALLISGISAGIVCTMAGQMVSEGALQWRLKPWLRRLVTRLITLTPSIVIAWAVGREGLDAALTGSQ
VALSSVLPFVTLPLIFFTSRSRYMTVRAEETERPGEGRDVDMSNSWAMTLVAGLVWLVITVMNVANLVLLGMGRA
G*
Coding >Hirsu2|4087
ATGGTCGCCGTCGCGTATATCGATCCGGGAAACTACGCGACGGACATCGTGGCCGGGTCGACGTACCAGTTCCGC
CTCCTGTTCGTCGTCCTCGTCAGTAACATGTTCGCCATCCTGCTGCAGAGCCTGGCGATCCGGCTCGGGACCGTG
ACCGGGCTCGACCTGTCGTCCATGTGCCGCGCGCAACTGCCGCGCTGGCTCAACTGGCTGCTGTACGCGCTGGCC
GAGGTGGCCATCATCGCCACCGACCTGGTCGAGGTCATCGGCATGGCCATCGCCATCAACCTGCTCATCCCCCAG
CTGCCTATGCCGGCCGCCTGTGCCCTAGCCTTCCTCGACGTCATGGCCATCCTCTTCTTCTACCGGCCGGACGGC
ACGATCCGCGGTCTCCGCCTCTTCGAGGCCTTTGTGAGCCTTCTCGTCCTCGGTGTCATTGTCTGCTTCTGCATA
CAGTTGTCCATGATCAAGGGCACCAGTGTCGGCACCGTCTTCCGAGGCTACCTGCCCTCCAAGGCCATCATCGAG
TCCGAAGGCATATACCAAGCGTGCGGCATCCTCGGCGCCACGGTCATGCCGCACAGCTTGTTCCTCGGCTCGGGC
CTCGTCCAACCTCGACTGAAGGAATACGACGCCAAGCAAGGGCTCATGCCGCCGAGCCAGGGAGGGCTCATGTCG
TCCGACGGAGGCGTGCACAGCAACGCGCCGTACGTGCCGTCGTACGCGGCCATCAAGCACTCGCTCAAGTACTCC
ATCACCGAGCTGGCCCTTTCGCTCTTCACCTTTGCGCTCTTCGTCAACTCGGCCATCCTCGTCGTCGCCGGCGCC
TCGCTATACCGGAACCCGGATGCGCTCGGCGCCGACATCTTCGGCATCCACGACCTGCTAGCCAAGAGCATATCA
CCGGCGGTGGGGACTATCTTCGCGCTGGCCCTGCTTATCTCGGGCATCTCGGCCGGCATCGTGTGCACCATGGCG
GGCCAGATGGTCAGCGAGGGCGCGCTGCAGTGGAGGCTGAAGCCGTGGCTGCGGCGGCTCGTCACGCGCCTCATC
ACGCTCACGCCGTCCATCGTCATCGCCTGGGCCGTGGGCCGGGAGGGCCTGGACGCGGCGCTGACGGGCTCGCAG
GTGGCGCTCAGCAGCGTTTTGCCCTTCGTCACCCTGCCGCTCATCTTCTTCACCAGCCGCAGCCGGTACATGACG
GTCCGGGCCGAGGAGACGGAGAGGCCCGGCGAGGGCAGGGACGTCGACATGTCCAACTCGTGGGCAATGACCCTG
GTCGCGGGTTTGGTCTGGCTCGTCATCACCGTCATGAATGTCGCCAACCTGGTCCTGCTGGGCATGGGCAGGGCG
GGCTGA
Transcript >Hirsu2|4087
ATGGTCGCCGTCGCGTATATCGATCCGGGAAACTACGCGACGGACATCGTGGCCGGGTCGACGTACCAGTTCCGC
CTCCTGTTCGTCGTCCTCGTCAGTAACATGTTCGCCATCCTGCTGCAGAGCCTGGCGATCCGGCTCGGGACCGTG
ACCGGGCTCGACCTGTCGTCCATGTGCCGCGCGCAACTGCCGCGCTGGCTCAACTGGCTGCTGTACGCGCTGGCC
GAGGTGGCCATCATCGCCACCGACCTGGTCGAGGTCATCGGCATGGCCATCGCCATCAACCTGCTCATCCCCCAG
CTGCCTATGCCGGCCGCCTGTGCCCTAGCCTTCCTCGACGTCATGGCCATCCTCTTCTTCTACCGGCCGGACGGC
ACGATCCGCGGTCTCCGCCTCTTCGAGGCCTTTGTGAGCCTTCTCGTCCTCGGTGTCATTGTCTGCTTCTGCATA
CAGTTGTCCATGATCAAGGGCACCAGTGTCGGCACCGTCTTCCGAGGCTACCTGCCCTCCAAGGCCATCATCGAG
TCCGAAGGCATATACCAAGCGTGCGGCATCCTCGGCGCCACGGTCATGCCGCACAGCTTGTTCCTCGGCTCGGGC
CTCGTCCAACCTCGACTGAAGGAATACGACGCCAAGCAAGGGCTCATGCCGCCGAGCCAGGGAGGGCTCATGTCG
TCCGACGGAGGCGTGCACAGCAACGCGCCGTACGTGCCGTCGTACGCGGCCATCAAGCACTCGCTCAAGTACTCC
ATCACCGAGCTGGCCCTTTCGCTCTTCACCTTTGCGCTCTTCGTCAACTCGGCCATCCTCGTCGTCGCCGGCGCC
TCGCTATACCGGAACCCGGATGCGCTCGGCGCCGACATCTTCGGCATCCACGACCTGCTAGCCAAGAGCATATCA
CCGGCGGTGGGGACTATCTTCGCGCTGGCCCTGCTTATCTCGGGCATCTCGGCCGGCATCGTGTGCACCATGGCG
GGCCAGATGGTCAGCGAGGGCGCGCTGCAGTGGAGGCTGAAGCCGTGGCTGCGGCGGCTCGTCACGCGCCTCATC
ACGCTCACGCCGTCCATCGTCATCGCCTGGGCCGTGGGCCGGGAGGGCCTGGACGCGGCGCTGACGGGCTCGCAG
GTGGCGCTCAGCAGCGTTTTGCCCTTCGTCACCCTGCCGCTCATCTTCTTCACCAGCCGCAGCCGGTACATGACG
GTCCGGGCCGAGGAGACGGAGAGGCCCGGCGAGGGCAGGGACGTCGACATGTCCAACTCGTGGGCAATGACCCTG
GTCGCGGGTTTGGTCTGGCTCGTCATCACCGTCATGAATGTCGCCAACCTGGTCCTGCTGGGCATGGGCAGGGCG
GGCTGA
Gene >Hirsu2|4087
ATGGTCGCCGTCGCGTATAGTCGGTCCTCCTTTCAGGCCTCGGGGAAGAAGACGGGGCTGACGCGGGGCAGTCGA
TCCGGGAAACTACGCGACGGACATCGTGGCCGGGTCGACGTACCAGTTCCGCCTCCTGTTCGTCGTCCTCGTCAG
TAACATGTTCGCCATCCTGCTGCAGAGCCTGGCGATCCGGCTCGGGACCGTGACCGGGCTCGACCTGTCGTCCAT
GTGCCGCGCGCAACTGCCGCGCTGGCTCAACTGGCTGCTGTACGCGCTGGCCGAGGTGGCCATCATCGCCACCGA
CCTGGTCGAGGTCATCGGCATGGCCATCGCCATCAACCTGCTCATCCCCCAGCTGCCTATGCCGGCCGCCTGTGC
CCTAGCCTTCCTCGACGTCATGGCCATCCTCTTCTTCTACCGGCCGGACGGCACGATCCGCGGTCTCCGCCTCTT
CGAGGCCTTTGTGAGCCTTCTCGTCCTCGGTGTCATTGTCTGCTTCTGCATACAGTTGTCCATGATCAAGGGCAC
CAGTGTCGGCACCGTCTTCCGAGGCTACCTGCCCTCCAAGGCCATCATCGAGTCCGAAGGGTAACGCCTCCGTCT
GACGCTACCGATCCTGCTGTTCCCCCGTTGCTGCCGTGTCCCGCTGACGACGGGGCCTTTCTGGCATCCAGCATA
TACCAAGCGTGCGGCATCCTCGGCGCCACGGTCATGCCGCACAGCTTGTTCCTCGGCTCGGGCCTCGTCCAACCT
CGACTGAAGGAATACGACGCCAAGCAAGGGCTCATGCCGCCGAGCCAGGGAGGGCTCATGTCGTCCGACGGAGGC
GTGCACAGCAACGCGCCGTACGTGCCGTCGTACGCGGCCATCAAGCACTCGCTCAAGTACTCCATCACCGAGCTG
GCCCTTTCGCTCTTCACCTTTGCGCTCTTCGTCAACTCGGCCATCCTCGTCGTCGCCGGCGCCTCGCTATACCGG
AACCCGGATGCGCTCGGCGCCGACATCTTCGGCATCCACGACCTGCTAGCCAAGAGCATATCACCGGCGGTGGGG
ACTATCTTCGCGCTGGCCCTGCTTATCTCGGGCATCTCGGCCGGCATCGTGTGCACCATGGCGGGCCAGATGGTC
AGCGAGGGCGCGCTGCAGTGGAGGCTGAAGCCGTGGCTGCGGCGGCTCGTCACGCGCCTCATCACGCTCACGCCG
TCCATCGTCATCGCCTGGGCCGTGGGCCGGGAGGGCCTGGACGCGGCGCTGACGGGCTCGCAGGTGGCGCTCAGC
AGCGTTTTGCCCTTCGTCACCCTGCCGCTCATCTTCTTCACCAGCCGCAGCCGGTACATGACGGTCCGGGCCGAG
GAGACGGAGAGGCCCGGCGAGGGCAGGGACGTCGACATGTCCAACTCGTGGGCAATGACCCTGGTCGCGGGTTTG
GTCTGGCTCGTCATCACCGTCATGAATGTCGCCAACCTGGTCCTGCTGGGCATGGGCAGGGCGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail