Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4079
Gene name
LocationContig_211:17299..18952
Strand-
Gene length (bp)1653
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00002 7tm_2 7 transmembrane receptor (Secretin family) 2.9E-05 68 307

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0004930 G protein-coupled receptor activity Yes
GO:0016021 integral component of membrane Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0007165 signal transduction No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0038023 signaling receptor activity No
GO:0004888 transmembrane signaling receptor activity No
GO:0003674 molecular_function No
GO:0060089 molecular transducer activity No
GO:0044425 membrane part No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 92 114 22
3 134 156 22
4 177 199 22
5 219 241 22
6 287 309 22
7 357 379 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4079
MVNFTGVNLCPPPFFDSKLFSEHGGYVDGRLCQRITGDLKCCLPCPMTDWVYPDSFGAVTATANWVATMSGICCV
VLVASWAALPIDKTHRHYLSVCLTLAVLLMNLGFIIPLAAQPEQCFDKITPHDMRSNKVCGVSGTLLILGGWCGV
MWAFLRSLSLHLQICWQVIVGRSFMVFAQAAGWGVPVLGIVLALVYSGVSFRFGATCHINHPNSLADLWIPLLVF
AAATVVITFATFGYCVKVYLAALSDDSASTATSGLPTYSNSVRTMTPRQAYRRVRRVVALQWRGIAIVLIIIADV
IFFSVVFVFQDHIVQSVTEDPEVAKDWVVCLIGASGDKKQCLDRARSMVVNQATVSAVLLLLSLNGIWLFFLLGR
ISMLTGWVEMARRLTDRRKKEFVSADARCEVKKDARAYEMLSRESSAVVSPLSTMKSRSEERGTHDHFDPDAHRY
HAPTQSYSSPRPPQHGVTAAAPTRPRSPEGGMNPLGLNHV*
Coding >Hirsu2|4079
ATGGTCAACTTTACCGGGGTCAACTTGTGCCCCCCGCCTTTTTTCGATTCTAAACTGTTCAGCGAGCATGGCGGA
TACGTCGACGGGCGCCTCTGCCAACGAATCACGGGCGATTTGAAATGCTGCCTGCCGTGCCCCATGACAGACTGG
GTCTACCCAGACAGCTTCGGCGCCGTGACGGCCACGGCAAACTGGGTGGCAACGATGAGCGGCATCTGCTGCGTG
GTCCTGGTGGCGTCGTGGGCGGCACTGCCCATCGACAAGACGCACCGCCATTACCTCAGCGTGTGCCTCACCCTT
GCCGTCCTCCTGATGAATCTTGGCTTCATCATCCCGCTGGCGGCGCAGCCGGAGCAGTGCTTCGACAAGATCACG
CCGCACGACATGCGAAGCAACAAGGTCTGCGGAGTCTCGGGCACGCTGCTCATACTCGGAGGCTGGTGCGGCGTC
ATGTGGGCCTTTCTCCGCTCCCTCTCCCTTCACCTGCAGATCTGCTGGCAGGTCATCGTCGGCCGCAGCTTCATG
GTGTTCGCGCAGGCGGCCGGCTGGGGCGTGCCGGTCCTGGGCATCGTCCTGGCCCTCGTCTACAGCGGCGTCTCG
TTCCGGTTCGGCGCGACGTGCCACATCAACCACCCCAACAGCCTGGCGGACCTGTGGATCCCGCTCCTCGTCTTC
GCCGCGGCGACCGTGGTCATCACGTTTGCGACCTTTGGCTACTGCGTCAAGGTCTACCTGGCGGCCCTGTCGGAC
GACTCGGCGTCGACGGCCACGTCGGGCCTGCCGACGTACAGCAACAGCGTGAGGACGATGACGCCGCGCCAGGCC
TACCGCCGCGTGCGGCGCGTCGTGGCGCTGCAGTGGCGCGGCATCGCCATCGTGCTCATCATCATCGCCGACGTC
ATCTTCTTCTCCGTCGTCTTCGTCTTCCAGGACCACATCGTGCAGTCGGTGACGGAGGACCCCGAGGTGGCCAAG
GACTGGGTCGTCTGCCTGATCGGGGCATCCGGCGACAAGAAGCAGTGCCTGGACAGGGCGAGGTCCATGGTCGTC
AACCAGGCGACCGTCTCGGCCGTCCTGCTGCTGCTCTCGCTGAACGGCATATGGCTCTTCTTCCTCCTCGGCCGA
ATCTCCATGCTGACGGGATGGGTCGAGATGGCGCGGCGGCTGACGGACCGCAGGAAGAAGGAGTTCGTCTCGGCC
GACGCCCGCTGCGAGGTCAAGAAGGACGCGCGGGCGTACGAGATGCTGTCGAGAGAGTCGAGCGCGGTGGTGTCG
CCGCTGTCGACGATGAAGTCGCGGTCGGAGGAGCGAGGGACGCACGACCACTTTGACCCAGACGCCCACCGCTAC
CACGCGCCGACGCAGTCGTATTCGAGCCCGCGGCCGCCGCAGCACGGCGTGACGGCGGCGGCGCCGACGCGGCCG
AGGAGTCCGGAGGGGGGGATGAACCCGCTGGGCCTGAATCACGTATAG
Transcript >Hirsu2|4079
ATGGTCAACTTTACCGGGGTCAACTTGTGCCCCCCGCCTTTTTTCGATTCTAAACTGTTCAGCGAGCATGGCGGA
TACGTCGACGGGCGCCTCTGCCAACGAATCACGGGCGATTTGAAATGCTGCCTGCCGTGCCCCATGACAGACTGG
GTCTACCCAGACAGCTTCGGCGCCGTGACGGCCACGGCAAACTGGGTGGCAACGATGAGCGGCATCTGCTGCGTG
GTCCTGGTGGCGTCGTGGGCGGCACTGCCCATCGACAAGACGCACCGCCATTACCTCAGCGTGTGCCTCACCCTT
GCCGTCCTCCTGATGAATCTTGGCTTCATCATCCCGCTGGCGGCGCAGCCGGAGCAGTGCTTCGACAAGATCACG
CCGCACGACATGCGAAGCAACAAGGTCTGCGGAGTCTCGGGCACGCTGCTCATACTCGGAGGCTGGTGCGGCGTC
ATGTGGGCCTTTCTCCGCTCCCTCTCCCTTCACCTGCAGATCTGCTGGCAGGTCATCGTCGGCCGCAGCTTCATG
GTGTTCGCGCAGGCGGCCGGCTGGGGCGTGCCGGTCCTGGGCATCGTCCTGGCCCTCGTCTACAGCGGCGTCTCG
TTCCGGTTCGGCGCGACGTGCCACATCAACCACCCCAACAGCCTGGCGGACCTGTGGATCCCGCTCCTCGTCTTC
GCCGCGGCGACCGTGGTCATCACGTTTGCGACCTTTGGCTACTGCGTCAAGGTCTACCTGGCGGCCCTGTCGGAC
GACTCGGCGTCGACGGCCACGTCGGGCCTGCCGACGTACAGCAACAGCGTGAGGACGATGACGCCGCGCCAGGCC
TACCGCCGCGTGCGGCGCGTCGTGGCGCTGCAGTGGCGCGGCATCGCCATCGTGCTCATCATCATCGCCGACGTC
ATCTTCTTCTCCGTCGTCTTCGTCTTCCAGGACCACATCGTGCAGTCGGTGACGGAGGACCCCGAGGTGGCCAAG
GACTGGGTCGTCTGCCTGATCGGGGCATCCGGCGACAAGAAGCAGTGCCTGGACAGGGCGAGGTCCATGGTCGTC
AACCAGGCGACCGTCTCGGCCGTCCTGCTGCTGCTCTCGCTGAACGGCATATGGCTCTTCTTCCTCCTCGGCCGA
ATCTCCATGCTGACGGGATGGGTCGAGATGGCGCGGCGGCTGACGGACCGCAGGAAGAAGGAGTTCGTCTCGGCC
GACGCCCGCTGCGAGGTCAAGAAGGACGCGCGGGCGTACGAGATGCTGTCGAGAGAGTCGAGCGCGGTGGTGTCG
CCGCTGTCGACGATGAAGTCGCGGTCGGAGGAGCGAGGGACGCACGACCACTTTGACCCAGACGCCCACCGCTAC
CACGCGCCGACGCAGTCGTATTCGAGCCCGCGGCCGCCGCAGCACGGCGTGACGGCGGCGGCGCCGACGCGGCCG
AGGAGTCCGGAGGGGGGGATGAACCCGCTGGGCCTGAATCACGTATAG
Gene >Hirsu2|4079
ATGGTCAACTTTACCGGGGTCAACTTGTGCCCCCCGCCTTTTTTCGATTCTAAACTGTTCAGCGAGCATGGCGGA
TGTAAGTGGCCAAGGCCTCGGTCAGGCACGATGCCGTCTGTTTTACGTATGTGCTGACGTCGACGACAGACGTCG
ACGGGCGCCTCTGCCAACGAATCACGGGCGATTTGAAATGCTGCCTGCCGTGCCCCATGACAGACTGGGTCTACC
CAGACAGCTTCGGCGCCGTGACGGCCACGGCAAACTGGGTGGCAACGATGAGCGGCATCTGCTGCGTGGTCCTGG
TGGCGTCGTGGGCGGCACTGCCCATCGACAAGACGCACCGCCATTACCTCAGCGTGTGCCTCACCCTTGCCGTCC
TCCTGATGAATGTGAGCGGCCCCCGGCGACGACGTGCCACGACTCGGCGCTGACCTTGCAGCTTGGCTTCATCAT
CCCGCTGGCGGCGCAGCCGGAGCAGTGCTTCGACAAGATCACGCCGCACGACATGCGAAGCAACAAGGTCTGCGG
AGTCTCGGGCACGCTGCTCATACTCGGAGGCTGGTGCGGCGTCATGTGGGCCTTTCTCCGCTCCCTCTCCCTTCA
CCTGCAGATCTGCTGGCAGGTCATCGTCGGCCGCAGCTTCATGGTGTTCGCGCAGGCGGCCGGCTGGGGCGTGCC
GGTCCTGGGCATCGTCCTGGCCCTCGTCTACAGCGGCGTCTCGTTCCGGTTCGGCGCGACGTGCCACATCAACCA
CCCCAACAGCCTGGCGGACCTGTGGATCCCGCTCCTCGTCTTCGCCGCGGCGACCGTGGTCATCACGTTTGCGAC
CTTTGGCTACTGCGTCAAGGTCTACCTGGCGGCCCTGTCGGACGACTCGGCGTCGACGGCCACGTCGGGCCTGCC
GACGTACAGCAACAGCGTGAGGACGATGACGCCGCGCCAGGCCTACCGCCGCGTGCGGCGCGTCGTGGCGCTGCA
GTGGCGCGGCATCGCCATCGTGCTCATCATCATCGCCGACGTCATCTTCTTCTCCGTCGTCTTCGTCTTCCAGGA
CCACATCGTGCAGTCGGTGACGGAGGACCCCGAGGTGGCCAAGGACTGGGTCGTCTGCCTGATCGGGGCATCCGG
CGACAAGAAGCAGTGCCTGGACAGGGCGAGGTCCATGGTCGTCAACCAGGCGACCGTCTCGGCCGTCCTGCTGCT
GCTCTCGGTAAGCTCAGGCCGCCCCGACCGCCGTGCGTGCGCGCGAGGATGCTGACGGCCCGATGCAAGCTGAAC
GGCATATGGCTCTTCTTCCTCCTCGGCCGAATCTCCATGCTGACGGGATGGGTCGAGATGGCGCGGCGGCTGACG
GACCGCAGGAAGAAGGAGTTCGTCTCGGCCGACGCCCGCTGCGAGGTCAAGAAGGACGCGCGGGCGTACGAGATG
CTGTCGAGAGAGTCGAGCGCGGTGGTGTCGCCGCTGTCGACGATGAAGTCGCGGTCGGAGGAGCGAGGGACGCAC
GACCACTTTGACCCAGACGCCCACCGCTACCACGCGCCGACGCAGTCGTATTCGAGCCCGCGGCCGCCGCAGCAC
GGCGTGACGGCGGCGGCGCCGACGCGGCCGAGGAGTCCGGAGGGGGGGATGAACCCGCTGGGCCTGAATCACGTA
TAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail