Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4077
Gene name
LocationContig_211:14004..15597
Strand-
Gene length (bp)1593
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 2.4E-34 199 493

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23548|GUN_PAEPO Endoglucanase OS=Paenibacillus polymyxa PE=3 SV=2 179 513 9.0E-40
sp|P54583|GUN1_ACIC1 Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_0614 PE=1 SV=1 179 513 1.0E-38
sp|P10474|GUNB_CALSA Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus GN=celB PE=3 SV=1 178 513 3.0E-26
sp|P50400|GUND_CELFI Endoglucanase D OS=Cellulomonas fimi GN=cenD PE=3 SV=1 178 513 1.0E-24
sp|P19487|GUNA_XANCP Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=engXCA PE=1 SV=2 183 528 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23548|GUN_PAEPO Endoglucanase OS=Paenibacillus polymyxa PE=3 SV=2 179 513 9.0E-40
sp|P54583|GUN1_ACIC1 Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_0614 PE=1 SV=1 179 513 1.0E-38
sp|P10474|GUNB_CALSA Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus GN=celB PE=3 SV=1 178 513 3.0E-26
sp|P50400|GUND_CELFI Endoglucanase D OS=Cellulomonas fimi GN=cenD PE=3 SV=1 178 513 1.0E-24
sp|P19487|GUNA_XANCP Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=engXCA PE=1 SV=2 183 528 1.0E-19
sp|P04956|GUNB_CLOTH Endoglucanase B OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celB PE=3 SV=1 178 460 3.0E-16
sp|Q05332|GUNG_CLOTH Endoglucanase G OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celG PE=3 SV=1 178 513 4.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 121 138 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4077
MASGGAPRRRPGLLLDLFSRTLARGHYGYHQPGLPLAVTQAAPASVADLESSSSSSSSQPPPLSPSSSSPPSASS
SSSPPPSPDSDSSPPPAWAHPKPRPRVLNVVRSCRRAVVGAPRKMFLLLLLLLGAVVLAAYIWRREARLLEPWEP
DLDALRFSKEPLPAPLARTNITDYRLPLRTRGRHVVDADGRRFKLSSVNWYGASDELFVPGGLDVRHRDSIARTI
RRLGFNSVRLPYADEMVLTNPVVDGRVVAANPDLAGRRALDVFEAVTTALTDAGVAVIVNNHITSATWCCGANPC
DAGWANDHLGPLCPVRQTEEQWMANWEAVMGRFRDNPLVIGADLRNEVRGLWGTMPWSRWAAAAERCGNRLLRLK
PDWLIVVEGTESANDLSGARDRPIRLDLPDRLVYSAHVYSWSGWGSLDGRFAQRTYSSFARAMRHNWAYLVENDI
APVWVGELGAPHHPTRGDAHYWKNLWRFLKSVDADFGYWALNARKPKDNEPETYSLLADDWETPVLDYRLRDMLD
LMRAQ*
Coding >Hirsu2|4077
ATGGCTTCTGGCGGGGCTCCGCGGCGGCGTCCGGGCCTGCTGCTGGACCTCTTCTCACGCACCTTGGCTCGGGGC
CACTACGGTTATCACCAGCCTGGCCTGCCCCTGGCGGTGACGCAAGCCGCGCCAGCTTCCGTCGCGGATCTCGAG
TCGTCGTCGTCGTCGTCGTCGTCGCAGCCGCCGCCGCTCTCTCCGTCTTCGTCTTCGCCGCCGTCGGCATCGTCG
TCGTCTTCGCCGCCGCCGTCGCCCGACTCGGATTCTTCGCCGCCGCCGGCCTGGGCGCATCCGAAGCCTCGTCCG
CGCGTCCTCAACGTCGTCCGCTCCTGCAGGCGAGCCGTCGTCGGCGCGCCGCGCAAGATGTTCCTCCTCCTCCTG
CTGCTGCTGGGCGCCGTCGTCCTGGCCGCCTACATCTGGCGGCGCGAGGCCCGGCTGCTGGAGCCGTGGGAGCCC
GACCTCGACGCCCTGCGCTTCAGCAAGGAGCCGCTGCCGGCGCCGCTGGCGCGGACCAACATCACCGACTACCGG
CTGCCGCTGCGGACGCGCGGGCGGCACGTCGTCGACGCCGACGGCCGCCGCTTCAAGCTGTCGTCGGTCAACTGG
TACGGCGCCAGCGACGAGCTCTTCGTGCCCGGCGGGCTCGACGTGCGGCACCGCGACAGCATCGCCCGCACCATC
CGCCGGCTCGGCTTCAACAGCGTGCGGCTGCCGTACGCCGACGAGATGGTGCTCACCAACCCCGTCGTCGACGGG
CGCGTCGTCGCCGCCAACCCGGACCTGGCCGGCCGGCGCGCCCTCGACGTCTTCGAGGCGGTGACGACGGCCCTG
ACCGACGCCGGCGTCGCCGTCATCGTCAACAACCACATCACCAGCGCCACCTGGTGCTGCGGCGCCAACCCGTGC
GACGCCGGCTGGGCCAACGACCACCTCGGCCCGCTCTGCCCCGTCCGCCAGACGGAGGAGCAGTGGATGGCCAAC
TGGGAGGCCGTCATGGGCCGCTTCCGCGACAACCCGCTCGTCATCGGCGCCGACCTGCGCAACGAGGTCCGCGGC
CTGTGGGGGACCATGCCGTGGTCCAGGTGGGCCGCCGCCGCCGAGCGCTGCGGCAACCGCCTGCTGCGCCTCAAG
CCCGACTGGCTCATCGTCGTCGAGGGCACCGAGTCGGCCAACGACCTGTCCGGCGCCCGCGACCGGCCCATCCGC
CTCGACCTGCCCGACCGCCTCGTCTACTCGGCCCACGTCTACTCCTGGTCCGGCTGGGGGAGCCTCGACGGCCGC
TTCGCCCAGCGCACCTACTCGTCCTTTGCCCGCGCCATGCGCCACAACTGGGCCTACCTGGTCGAGAACGACATC
GCGCCCGTCTGGGTCGGCGAGCTCGGCGCCCCGCACCACCCGACCCGCGGCGACGCCCACTACTGGAAGAACCTG
TGGCGCTTCCTCAAGTCCGTCGACGCCGACTTCGGCTACTGGGCCCTGAACGCCCGCAAGCCCAAGGACAACGAG
CCGGAGACGTACTCGCTCCTGGCCGACGACTGGGAGACGCCCGTGCTGGATTACCGCTTGAGGGACATGCTGGAC
CTCATGCGCGCCCAATGA
Transcript >Hirsu2|4077
ATGGCTTCTGGCGGGGCTCCGCGGCGGCGTCCGGGCCTGCTGCTGGACCTCTTCTCACGCACCTTGGCTCGGGGC
CACTACGGTTATCACCAGCCTGGCCTGCCCCTGGCGGTGACGCAAGCCGCGCCAGCTTCCGTCGCGGATCTCGAG
TCGTCGTCGTCGTCGTCGTCGTCGCAGCCGCCGCCGCTCTCTCCGTCTTCGTCTTCGCCGCCGTCGGCATCGTCG
TCGTCTTCGCCGCCGCCGTCGCCCGACTCGGATTCTTCGCCGCCGCCGGCCTGGGCGCATCCGAAGCCTCGTCCG
CGCGTCCTCAACGTCGTCCGCTCCTGCAGGCGAGCCGTCGTCGGCGCGCCGCGCAAGATGTTCCTCCTCCTCCTG
CTGCTGCTGGGCGCCGTCGTCCTGGCCGCCTACATCTGGCGGCGCGAGGCCCGGCTGCTGGAGCCGTGGGAGCCC
GACCTCGACGCCCTGCGCTTCAGCAAGGAGCCGCTGCCGGCGCCGCTGGCGCGGACCAACATCACCGACTACCGG
CTGCCGCTGCGGACGCGCGGGCGGCACGTCGTCGACGCCGACGGCCGCCGCTTCAAGCTGTCGTCGGTCAACTGG
TACGGCGCCAGCGACGAGCTCTTCGTGCCCGGCGGGCTCGACGTGCGGCACCGCGACAGCATCGCCCGCACCATC
CGCCGGCTCGGCTTCAACAGCGTGCGGCTGCCGTACGCCGACGAGATGGTGCTCACCAACCCCGTCGTCGACGGG
CGCGTCGTCGCCGCCAACCCGGACCTGGCCGGCCGGCGCGCCCTCGACGTCTTCGAGGCGGTGACGACGGCCCTG
ACCGACGCCGGCGTCGCCGTCATCGTCAACAACCACATCACCAGCGCCACCTGGTGCTGCGGCGCCAACCCGTGC
GACGCCGGCTGGGCCAACGACCACCTCGGCCCGCTCTGCCCCGTCCGCCAGACGGAGGAGCAGTGGATGGCCAAC
TGGGAGGCCGTCATGGGCCGCTTCCGCGACAACCCGCTCGTCATCGGCGCCGACCTGCGCAACGAGGTCCGCGGC
CTGTGGGGGACCATGCCGTGGTCCAGGTGGGCCGCCGCCGCCGAGCGCTGCGGCAACCGCCTGCTGCGCCTCAAG
CCCGACTGGCTCATCGTCGTCGAGGGCACCGAGTCGGCCAACGACCTGTCCGGCGCCCGCGACCGGCCCATCCGC
CTCGACCTGCCCGACCGCCTCGTCTACTCGGCCCACGTCTACTCCTGGTCCGGCTGGGGGAGCCTCGACGGCCGC
TTCGCCCAGCGCACCTACTCGTCCTTTGCCCGCGCCATGCGCCACAACTGGGCCTACCTGGTCGAGAACGACATC
GCGCCCGTCTGGGTCGGCGAGCTCGGCGCCCCGCACCACCCGACCCGCGGCGACGCCCACTACTGGAAGAACCTG
TGGCGCTTCCTCAAGTCCGTCGACGCCGACTTCGGCTACTGGGCCCTGAACGCCCGCAAGCCCAAGGACAACGAG
CCGGAGACGTACTCGCTCCTGGCCGACGACTGGGAGACGCCCGTGCTGGATTACCGCTTGAGGGACATGCTGGAC
CTCATGCGCGCCCAATGA
Gene >Hirsu2|4077
ATGGCTTCTGGCGGGGCTCCGCGGCGGCGTCCGGGCCTGCTGCTGGACCTCTTCTCACGCACCTTGGCTCGGGGC
CACTACGGTTATCACCAGCCTGGCCTGCCCCTGGCGGTGACGCAAGCCGCGCCAGCTTCCGTCGCGGATCTCGAG
TCGTCGTCGTCGTCGTCGTCGTCGCAGCCGCCGCCGCTCTCTCCGTCTTCGTCTTCGCCGCCGTCGGCATCGTCG
TCGTCTTCGCCGCCGCCGTCGCCCGACTCGGATTCTTCGCCGCCGCCGGCCTGGGCGCATCCGAAGCCTCGTCCG
CGCGTCCTCAACGTCGTCCGCTCCTGCAGGCGAGCCGTCGTCGGCGCGCCGCGCAAGATGTTCCTCCTCCTCCTG
CTGCTGCTGGGCGCCGTCGTCCTGGCCGCCTACATCTGGCGGCGCGAGGCCCGGCTGCTGGAGCCGTGGGAGCCC
GACCTCGACGCCCTGCGCTTCAGCAAGGAGCCGCTGCCGGCGCCGCTGGCGCGGACCAACATCACCGACTACCGG
CTGCCGCTGCGGACGCGCGGGCGGCACGTCGTCGACGCCGACGGCCGCCGCTTCAAGCTGTCGTCGGTCAACTGG
TACGGCGCCAGCGACGAGCTCTTCGTGCCCGGCGGGCTCGACGTGCGGCACCGCGACAGCATCGCCCGCACCATC
CGCCGGCTCGGCTTCAACAGCGTGCGGCTGCCGTACGCCGACGAGATGGTGCTCACCAACCCCGTCGTCGACGGG
CGCGTCGTCGCCGCCAACCCGGACCTGGCCGGCCGGCGCGCCCTCGACGTCTTCGAGGCGGTGACGACGGCCCTG
ACCGACGCCGGCGTCGCCGTCATCGTCAACAACCACATCACCAGCGCCACCTGGTGCTGCGGCGCCAACCCGTGC
GACGCCGGCTGGGCCAACGACCACCTCGGCCCGCTCTGCCCCGTCCGCCAGACGGAGGAGCAGTGGATGGCCAAC
TGGGAGGCCGTCATGGGCCGCTTCCGCGACAACCCGCTCGTCATCGGCGCCGACCTGCGCAACGAGGTCCGCGGC
CTGTGGGGGACCATGCCGTGGTCCAGGTGGGCCGCCGCCGCCGAGCGCTGCGGCAACCGCCTGCTGCGCCTCAAG
CCCGACTGGCTCATCGTCGTCGAGGGCACCGAGTCGGCCAACGACCTGTCCGGCGCCCGCGACCGGCCCATCCGC
CTCGACCTGCCCGACCGCCTCGTCTACTCGGCCCACGTCTACTCCTGGTCCGGCTGGGGGAGCCTCGACGGCCGC
TTCGCCCAGCGCACCTACTCGTCCTTTGCCCGCGCCATGCGCCACAACTGGGCCTACCTGGTCGAGAACGACATC
GCGCCCGTCTGGGTCGGCGAGCTCGGCGCCCCGCACCACCCGACCCGCGGCGACGCCCACTACTGGAAGAACCTG
TGGCGCTTCCTCAAGTCCGTCGACGCCGACTTCGGCTACTGGGCCCTGAACGCCCGCAAGCCCAAGGACAACGAG
CCGGAGACGTACTCGCTCCTGGCCGACGACTGGGAGACGCCCGTGCTGGATTACCGCTTGAGGGACATGCTGGAC
CTCATGCGCGCCCAATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail