Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4073
Gene name
LocationContig_211:3767..4322
Strand-
Gene length (bp)555
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00909 Ammonium_transp Ammonium Transporter Family 2.4E-24 5 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53390|MEP3_YEAST Ammonium transporter MEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP3 PE=1 SV=1 5 128 1.0E-36
sp|P40260|MEP1_YEAST Ammonium transporter MEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP1 PE=1 SV=1 5 128 1.0E-33
sp|Q9US00|AMT2_SCHPO Ammonium transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt2 PE=3 SV=1 5 137 8.0E-27
sp|Q9C0V1|AMT1_SCHPO Ammonium transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt1 PE=3 SV=1 5 118 1.0E-26
sp|P41948|MEP2_YEAST Ammonium transporter MEP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP2 PE=1 SV=1 5 168 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53390|MEP3_YEAST Ammonium transporter MEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP3 PE=1 SV=1 5 128 1.0E-36
sp|P40260|MEP1_YEAST Ammonium transporter MEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP1 PE=1 SV=1 5 128 1.0E-33
sp|Q9US00|AMT2_SCHPO Ammonium transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt2 PE=3 SV=1 5 137 8.0E-27
sp|Q9C0V1|AMT1_SCHPO Ammonium transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt1 PE=3 SV=1 5 118 1.0E-26
sp|P41948|MEP2_YEAST Ammonium transporter MEP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP2 PE=1 SV=1 5 168 1.0E-16
sp|Q9P7F3|AMT3_SCHPO Ammonium transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt3 PE=3 SV=1 9 107 1.0E-14
sp|Q07429|NRGA_BACSU Ammonium transporter NrgA OS=Bacillus subtilis (strain 168) GN=nrgA PE=2 SV=1 12 117 6.0E-12
sp|P69681|AMTB_ECOLI Ammonia channel OS=Escherichia coli (strain K12) GN=amtB PE=1 SV=1 4 117 8.0E-10
sp|P69680|AMTB_ECO57 Ammonia channel OS=Escherichia coli O157:H7 GN=amtB PE=1 SV=1 4 117 8.0E-10
sp|P54146|AMT_CORGL Ammonia channel OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=amt PE=2 SV=1 10 116 2.0E-09
sp|P54144|AMT11_ARATH Ammonium transporter 1 member 1 OS=Arabidopsis thaliana GN=AMT1-1 PE=1 SV=1 9 157 3.0E-08
sp|Q9BLG4|AMT1_DICDI Ammonium transporter 1 OS=Dictyostelium discoideum GN=amtA PE=1 SV=1 4 124 4.0E-08
sp|P54145|AMT1_CAEEL Putative ammonium transporter 1 OS=Caenorhabditis elegans GN=amt-1 PE=3 SV=1 9 116 2.0E-07
sp|Q8S230|AMT22_ORYSJ Ammonium transporter 2 member 2 OS=Oryza sativa subsp. japonica GN=AMT2-2 PE=2 SV=2 7 116 2.0E-06
sp|Q9SQH9|AMT13_ARATH Ammonium transporter 1 member 3 OS=Arabidopsis thaliana GN=AMT1-3 PE=2 SV=2 8 118 3.0E-06
sp|Q9LK16|AMT15_ARATH Putative ammonium transporter 1 member 5 OS=Arabidopsis thaliana GN=AMT1-5 PE=3 SV=1 8 118 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008519 ammonium transmembrane transporter activity Yes
GO:0015696 ammonium transport Yes
GO:0016020 membrane Yes
GO:0008324 cation transmembrane transporter activity No
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 61 83 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4073
MSPLVKYLIRIDDSLDVFAEHGIGGIVGLIFNAFFATGRTIGLDGVNTGASGGFLDGKYIVLGWQIAAIVAASAY
AFVVSAIIAKLIDLVPGLKLRASEEAELLGMDDDQHGEFSYDYVEVRRDFLAWSPHRGEPAGDGVTIEPQLGIPA
HANMAPSSEKSSRVSSDHGAEGLTTAAATTTTTT*
Coding >Hirsu2|4073
ATGTCTCCTTTAGTCAAGTACCTGATACGCATTGACGACTCGCTCGACGTCTTTGCCGAGCACGGCATTGGCGGC
ATCGTCGGCCTCATCTTCAACGCCTTCTTCGCCACCGGCAGGACCATCGGTCTCGACGGCGTCAACACGGGCGCC
TCGGGCGGCTTTCTCGATGGCAAGTACATCGTCCTCGGCTGGCAGATCGCCGCCATCGTCGCCGCCAGCGCCTAC
GCATTCGTCGTGTCCGCCATCATCGCCAAGCTCATCGACCTCGTGCCCGGCCTCAAGCTGCGGGCTTCGGAGGAG
GCTGAGTTGCTCGGAATGGATGACGATCAGCACGGCGAGTTCTCGTACGACTACGTCGAAGTCCGCCGTGACTTC
CTGGCCTGGAGCCCGCATCGCGGCGAGCCCGCCGGCGACGGCGTGACCATTGAGCCCCAACTCGGTATCCCGGCG
CACGCCAACATGGCTCCGTCCTCGGAGAAGAGTTCGCGGGTCTCGTCCGATCATGGCGCAGAGGGCCTGACGACG
GCGGCCGCGACGACGACGACGACGACGTGA
Transcript >Hirsu2|4073
ATGTCTCCTTTAGTCAAGTACCTGATACGCATTGACGACTCGCTCGACGTCTTTGCCGAGCACGGCATTGGCGGC
ATCGTCGGCCTCATCTTCAACGCCTTCTTCGCCACCGGCAGGACCATCGGTCTCGACGGCGTCAACACGGGCGCC
TCGGGCGGCTTTCTCGATGGCAAGTACATCGTCCTCGGCTGGCAGATCGCCGCCATCGTCGCCGCCAGCGCCTAC
GCATTCGTCGTGTCCGCCATCATCGCCAAGCTCATCGACCTCGTGCCCGGCCTCAAGCTGCGGGCTTCGGAGGAG
GCTGAGTTGCTCGGAATGGATGACGATCAGCACGGCGAGTTCTCGTACGACTACGTCGAAGTCCGCCGTGACTTC
CTGGCCTGGAGCCCGCATCGCGGCGAGCCCGCCGGCGACGGCGTGACCATTGAGCCCCAACTCGGTATCCCGGCG
CACGCCAACATGGCTCCGTCCTCGGAGAAGAGTTCGCGGGTCTCGTCCGATCATGGCGCAGAGGGCCTGACGACG
GCGGCCGCGACGACGACGACGACGACGTGA
Gene >Hirsu2|4073
ATGTCTCCTTTAGTCAAGTACCTGATACGCATTGACGACTCGCTCGACGTCTTTGCCGAGCACGGCATTGGCGGC
ATCGTCGGCCTCATCTTCAACGCCTTCTTCGCCACCGGCAGGACCATCGGTCTCGACGGCGTCAACACGGGCGCC
TCGGGCGGCTTTCTCGATGGCAAGTACATCGTCCTCGGCTGGCAGATCGCCGCCATCGTCGCCGCCAGCGCCTAC
GCATTCGTCGTGTCCGCCATCATCGCCAAGCTCATCGACCTCGTGCCCGGCCTCAAGCTGCGGGCTTCGGAGGAG
GCTGAGTTGCTCGGAATGGATGACGATCAGCACGGCGAGTTCTCGTACGACTACGTCGAAGTCCGCCGTGACTTC
CTGGCCTGGAGCCCGCATCGCGGCGAGCCCGCCGGCGACGGCGTGACCATTGAGCCCCAACTCGGTATCCCGGCG
CACGCCAACATGGCTCCGTCCTCGGAGAAGAGTTCGCGGGTCTCGTCCGATCATGGCGCAGAGGGCCTGACGACG
GCGGCCGCGACGACGACGACGACGACGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail