Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4046
Gene name
LocationContig_21:51134..52756
Strand-
Gene length (bp)1622
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain 3.5E-19 414 484
PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain 8.5E-17 339 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33759|RT05_YEAST 37S ribosomal protein S5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS5 PE=1 SV=1 340 496 1.0E-36
sp|Q10234|RT05_SCHPO Probable 37S ribosomal protein S5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp5 PE=1 SV=1 342 496 1.0E-35
sp|Q99N87|RT05_MOUSE 28S ribosomal protein S5, mitochondrial OS=Mus musculus GN=Mrps5 PE=1 SV=1 340 493 6.0E-17
sp|Q5REJ1|RT05_PONAB 28S ribosomal protein S5, mitochondrial OS=Pongo abelii GN=MRPS5 PE=2 SV=1 340 493 3.0E-16
sp|P82675|RT05_HUMAN 28S ribosomal protein S5, mitochondrial OS=Homo sapiens GN=MRPS5 PE=1 SV=2 340 493 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33759|RT05_YEAST 37S ribosomal protein S5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS5 PE=1 SV=1 340 496 1.0E-36
sp|Q10234|RT05_SCHPO Probable 37S ribosomal protein S5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp5 PE=1 SV=1 342 496 1.0E-35
sp|Q99N87|RT05_MOUSE 28S ribosomal protein S5, mitochondrial OS=Mus musculus GN=Mrps5 PE=1 SV=1 340 493 6.0E-17
sp|Q5REJ1|RT05_PONAB 28S ribosomal protein S5, mitochondrial OS=Pongo abelii GN=MRPS5 PE=2 SV=1 340 493 3.0E-16
sp|P82675|RT05_HUMAN 28S ribosomal protein S5, mitochondrial OS=Homo sapiens GN=MRPS5 PE=1 SV=2 340 493 5.0E-16
sp|Q2KID9|RT05_BOVIN 28S ribosomal protein S5, mitochondrial OS=Bos taurus GN=MRPS5 PE=1 SV=1 340 493 2.0E-15
sp|Q93425|RT05_CAEEL Putative 28S ribosomal protein S5, mitochondrial OS=Caenorhabditis elegans GN=mrps-5 PE=3 SV=3 326 491 5.0E-14
sp|A8Y3Q1|RT05_CAEBR Putative 28S ribosomal protein S5, mitochondrial OS=Caenorhabditis briggsae GN=mrps-5 PE=3 SV=3 330 491 2.0E-13
sp|P57574|RS5_BUCAI 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsE PE=3 SV=1 340 491 6.0E-13
sp|A1W325|RS5_ACISJ 30S ribosomal protein S5 OS=Acidovorax sp. (strain JS42) GN=rpsE PE=3 SV=1 335 491 1.0E-12
sp|B9MBV4|RS5_ACIET 30S ribosomal protein S5 OS=Acidovorax ebreus (strain TPSY) GN=rpsE PE=3 SV=1 335 491 1.0E-12
sp|A1TJT4|RS5_ACIAC 30S ribosomal protein S5 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsE PE=3 SV=1 340 491 2.0E-12
sp|C4L7U7|RS5_TOLAT 30S ribosomal protein S5 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsE PE=3 SV=1 340 491 2.0E-12
sp|Q87SZ6|RS5_VIBPA 30S ribosomal protein S5 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsE PE=3 SV=1 332 485 8.0E-12
sp|A7MWH5|RS5_VIBCB 30S ribosomal protein S5 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsE PE=3 SV=1 332 485 8.0E-12
sp|Q7MPH1|RS5_VIBVY 30S ribosomal protein S5 OS=Vibrio vulnificus (strain YJ016) GN=rpsE PE=3 SV=1 332 485 1.0E-11
sp|Q8DE57|RS5_VIBVU 30S ribosomal protein S5 OS=Vibrio vulnificus (strain CMCP6) GN=rpsE PE=3 SV=1 332 485 1.0E-11
sp|Q8K966|RS5_BUCAP 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsE PE=3 SV=1 340 491 1.0E-11
sp|A9KWB9|RS5_SHEB9 30S ribosomal protein S5 OS=Shewanella baltica (strain OS195) GN=rpsE PE=3 SV=1 335 492 2.0E-11
sp|A6WHU5|RS5_SHEB8 30S ribosomal protein S5 OS=Shewanella baltica (strain OS185) GN=rpsE PE=3 SV=1 335 492 2.0E-11
sp|A3DA55|RS5_SHEB5 30S ribosomal protein S5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsE PE=3 SV=1 335 492 2.0E-11
sp|B8EBI8|RS5_SHEB2 30S ribosomal protein S5 OS=Shewanella baltica (strain OS223) GN=rpsE PE=3 SV=1 335 492 2.0E-11
sp|Q5GSW1|RS5_WOLTR 30S ribosomal protein S5 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsE PE=3 SV=1 345 491 2.0E-11
sp|A1RED1|RS5_SHESW 30S ribosomal protein S5 OS=Shewanella sp. (strain W3-18-1) GN=rpsE PE=3 SV=1 335 492 2.0E-11
sp|A4YBW6|RS5_SHEPC 30S ribosomal protein S5 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsE PE=3 SV=1 335 492 2.0E-11
sp|Q7VKF0|RS5_HAEDU 30S ribosomal protein S5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsE PE=3 SV=1 340 491 2.0E-11
sp|Q089N7|RS5_SHEFN 30S ribosomal protein S5 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsE PE=3 SV=1 335 492 3.0E-11
sp|Q12SU2|RS5_SHEDO 30S ribosomal protein S5 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsE PE=3 SV=1 335 492 3.0E-11
sp|Q0I088|RS5_SHESR 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-7) GN=rpsE PE=3 SV=1 335 492 3.0E-11
sp|Q0HNS0|RS5_SHESM 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-4) GN=rpsE PE=3 SV=1 335 492 3.0E-11
sp|A0KRP1|RS5_SHESA 30S ribosomal protein S5 OS=Shewanella sp. (strain ANA-3) GN=rpsE PE=3 SV=1 335 492 3.0E-11
sp|P59124|RS5_SHEON 30S ribosomal protein S5 OS=Shewanella oneidensis (strain MR-1) GN=rpsE PE=3 SV=1 335 492 3.0E-11
sp|Q2RQX7|RS5_RHORT 30S ribosomal protein S5 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsE PE=3 SV=1 313 491 3.0E-11
sp|A0KF38|RS5_AERHH 30S ribosomal protein S5 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsE PE=3 SV=1 340 491 4.0E-11
sp|A1WK99|RS5_VEREI 30S ribosomal protein S5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsE PE=3 SV=1 335 491 4.0E-11
sp|Q2N9C8|RS5_ERYLH 30S ribosomal protein S5 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsE PE=3 SV=1 333 491 4.0E-11
sp|Q9Z7S3|RS5_CHLPN 30S ribosomal protein S5 OS=Chlamydia pneumoniae GN=rpsE PE=3 SV=1 340 471 4.0E-11
sp|Q1LTC1|RS5_BAUCH 30S ribosomal protein S5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsE PE=3 SV=1 333 491 4.0E-11
sp|B7VLE0|RS5_VIBTL 30S ribosomal protein S5 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsE PE=3 SV=1 340 485 5.0E-11
sp|Q7MYG8|RS5_PHOLL 30S ribosomal protein S5 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsE PE=3 SV=1 340 491 5.0E-11
sp|A4SSY9|RS5_AERS4 30S ribosomal protein S5 OS=Aeromonas salmonicida (strain A449) GN=rpsE PE=3 SV=1 340 491 7.0E-11
sp|Q5L704|RS5_CHLAB 30S ribosomal protein S5 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsE PE=3 SV=1 340 480 7.0E-11
sp|Q493J1|RS5_BLOPB 30S ribosomal protein S5 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsE PE=3 SV=1 340 495 7.0E-11
sp|Q6CZY7|RS5_PECAS 30S ribosomal protein S5 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsE PE=3 SV=1 340 491 7.0E-11
sp|C3LRP1|RS5_VIBCM 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsE PE=3 SV=1 332 485 8.0E-11
sp|Q9KP01|RS5_VIBCH 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsE PE=3 SV=1 332 485 8.0E-11
sp|A5F563|RS5_VIBC3 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsE PE=3 SV=1 332 485 8.0E-11
sp|A2SLE0|RS5_METPP 30S ribosomal protein S5 OS=Methylibium petroleiphilum (strain PM1) GN=rpsE PE=3 SV=1 342 488 8.0E-11
sp|A1S235|RS5_SHEAM 30S ribosomal protein S5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsE PE=3 SV=1 340 492 9.0E-11
sp|Q2NQN9|RS5_SODGM 30S ribosomal protein S5 OS=Sodalis glossinidius (strain morsitans) GN=rpsE PE=3 SV=1 340 491 1.0E-10
sp|A7MPG7|RS5_CROS8 30S ribosomal protein S5 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsE PE=3 SV=1 340 491 1.0E-10
sp|Q2W2K8|RS5_MAGSA 30S ribosomal protein S5 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsE PE=3 SV=1 335 491 1.0E-10
sp|A1KRJ0|RS5_NEIMF 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsE PE=3 SV=1 335 497 1.0E-10
sp|P66577|RS5_NEIMB 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsE PE=3 SV=1 335 497 1.0E-10
sp|P66576|RS5_NEIMA 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsE PE=3 SV=1 335 497 1.0E-10
sp|A9M3U9|RS5_NEIM0 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsE PE=3 SV=1 335 497 1.0E-10
sp|Q5F5U4|RS5_NEIG1 30S ribosomal protein S5 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsE PE=3 SV=1 335 497 1.0E-10
sp|A9BRW8|RS5_DELAS 30S ribosomal protein S5 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsE PE=3 SV=1 335 491 1.0E-10
sp|Q73HA3|RS5_WOLPM 30S ribosomal protein S5 OS=Wolbachia pipientis wMel GN=rpsE PE=3 SV=1 345 491 1.0E-10
sp|B5ZB57|RS5_UREU1 30S ribosomal protein S5 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsE PE=3 SV=1 339 481 2.0E-10
sp|Q5QXW2|RS5_IDILO 30S ribosomal protein S5 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsE PE=3 SV=1 337 491 2.0E-10
sp|Q9PQP3|RS5_UREPA 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsE PE=3 SV=1 339 481 2.0E-10
sp|B1AIN7|RS5_UREP2 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsE PE=3 SV=1 339 481 2.0E-10
sp|Q9A8T6|RS5_CAUCR 30S ribosomal protein S5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsE PE=3 SV=1 337 491 2.0E-10
sp|B8H4F1|RS5_CAUCN 30S ribosomal protein S5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsE PE=3 SV=1 337 491 2.0E-10
sp|Q32B48|RS5_SHIDS 30S ribosomal protein S5 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsE PE=3 SV=1 340 491 2.0E-10
sp|Q252W9|RS5_CHLFF 30S ribosomal protein S5 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsE PE=3 SV=1 335 473 2.0E-10
sp|A7HWS8|RS5_PARL1 30S ribosomal protein S5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsE PE=3 SV=1 342 491 3.0E-10
sp|Q65QX2|RS5_MANSM 30S ribosomal protein S5 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|Q3YWV6|RS5_SHISS 30S ribosomal protein S5 OS=Shigella sonnei (strain Ss046) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|P0A7W6|RS5_SHIFL 30S ribosomal protein S5 OS=Shigella flexneri GN=rpsE PE=3 SV=2 340 491 3.0E-10
sp|Q0SZZ9|RS5_SHIF8 30S ribosomal protein S5 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|Q31VX3|RS5_SHIBS 30S ribosomal protein S5 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|P0A7W4|RS5_SALTY 30S ribosomal protein S5 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsE PE=1 SV=2 340 491 3.0E-10
sp|P0A7W5|RS5_SALTI 30S ribosomal protein S5 OS=Salmonella typhi GN=rpsE PE=3 SV=2 340 491 3.0E-10
sp|A9MSY1|RS5_SALPB 30S ribosomal protein S5 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|Q5PK01|RS5_SALPA 30S ribosomal protein S5 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|Q57J49|RS5_SALCH 30S ribosomal protein S5 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|A9MN66|RS5_SALAR 30S ribosomal protein S5 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|Q1R627|RS5_ECOUT 30S ribosomal protein S5 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|P0A7W1|RS5_ECOLI 30S ribosomal protein S5 OS=Escherichia coli (strain K12) GN=rpsE PE=1 SV=2 340 491 3.0E-10
sp|B1IPZ6|RS5_ECOLC 30S ribosomal protein S5 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|P0A7W2|RS5_ECOL6 30S ribosomal protein S5 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsE PE=3 SV=2 340 491 3.0E-10
sp|Q0TCF8|RS5_ECOL5 30S ribosomal protein S5 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|A1AGJ2|RS5_ECOK1 30S ribosomal protein S5 OS=Escherichia coli O1:K1 / APEC GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|A8A5A8|RS5_ECOHS 30S ribosomal protein S5 OS=Escherichia coli O9:H4 (strain HS) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|P0A7W3|RS5_ECO57 30S ribosomal protein S5 OS=Escherichia coli O157:H7 GN=rpsE PE=3 SV=2 340 491 3.0E-10
sp|A7ZSJ2|RS5_ECO24 30S ribosomal protein S5 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|A8AQJ8|RS5_CITK8 30S ribosomal protein S5 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|A4WFB1|RS5_ENT38 30S ribosomal protein S5 OS=Enterobacter sp. (strain 638) GN=rpsE PE=3 SV=1 340 491 3.0E-10
sp|P44374|RS5_HAEIN 30S ribosomal protein S5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsE PE=3 SV=1 333 491 4.0E-10
sp|A5UHU8|RS5_HAEIG 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittGG) GN=rpsE PE=3 SV=1 333 491 4.0E-10
sp|A5UDT0|RS5_HAEIE 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittEE) GN=rpsE PE=3 SV=1 333 491 4.0E-10
sp|Q4QMA4|RS5_HAEI8 30S ribosomal protein S5 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsE PE=3 SV=1 333 491 4.0E-10
sp|B0T2D9|RS5_CAUSK 30S ribosomal protein S5 OS=Caulobacter sp. (strain K31) GN=rpsE PE=3 SV=1 337 491 4.0E-10
sp|Q28UT7|RS5_JANSC 30S ribosomal protein S5 OS=Jannaschia sp. (strain CCS1) GN=rpsE PE=3 SV=1 339 491 4.0E-10
sp|A3N374|RS5_ACTP2 30S ribosomal protein S5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsE PE=3 SV=1 340 491 4.0E-10
sp|Q5NQ48|RS5_ZYMMO 30S ribosomal protein S5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsE PE=3 SV=1 335 491 4.0E-10
sp|A3Q999|RS5_SHELP 30S ribosomal protein S5 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsE PE=3 SV=1 329 492 5.0E-10
sp|Q3YRM6|RS5_EHRCJ 30S ribosomal protein S5 OS=Ehrlichia canis (strain Jake) GN=rpsE PE=3 SV=1 345 491 5.0E-10
sp|B0UX31|RS5_HISS2 30S ribosomal protein S5 OS=Histophilus somni (strain 2336) GN=rpsE PE=3 SV=1 340 491 5.0E-10
sp|Q0I145|RS5_HAES1 30S ribosomal protein S5 OS=Haemophilus somnus (strain 129Pt) GN=rpsE PE=3 SV=1 340 491 5.0E-10
sp|B4R8N4|RS5_PHEZH 30S ribosomal protein S5 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsE PE=3 SV=1 337 491 5.0E-10
sp|Q4FLN5|RS5_PELUB 30S ribosomal protein S5 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsE PE=3 SV=1 335 491 6.0E-10
sp|A5FZU8|RS5_ACICJ 30S ribosomal protein S5 OS=Acidiphilium cryptum (strain JF-5) GN=rpsE PE=3 SV=1 340 491 6.0E-10
sp|Q47LL0|RS5_THEFY 30S ribosomal protein S5 OS=Thermobifida fusca (strain YX) GN=rpsE PE=3 SV=1 334 491 7.0E-10
sp|Q83EQ9|RS5_COXBU 30S ribosomal protein S5 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsE PE=3 SV=1 335 491 7.0E-10
sp|P0A4C8|RS5_CHLTR 30S ribosomal protein S5 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsE PE=3 SV=1 335 472 7.0E-10
sp|Q3KLI5|RS5_CHLTA 30S ribosomal protein S5 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsE PE=3 SV=1 335 472 7.0E-10
sp|P0A4C9|RS5_CHLMU 30S ribosomal protein S5 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsE PE=3 SV=1 335 472 7.0E-10
sp|Q824N5|RS5_CHLCV 30S ribosomal protein S5 OS=Chlamydophila caviae (strain GPIC) GN=rpsE PE=3 SV=1 340 480 8.0E-10
sp|Q9CL47|RS5_PASMU 30S ribosomal protein S5 OS=Pasteurella multocida (strain Pm70) GN=rpsE PE=3 SV=1 340 491 9.0E-10
sp|A8IAP6|RS5_AZOC5 30S ribosomal protein S5 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsE PE=3 SV=1 342 488 9.0E-10
sp|A1A086|RS5_BIFAA 30S ribosomal protein S5 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rpsE PE=3 SV=1 333 491 9.0E-10
sp|Q12G86|RS5_POLSJ 30S ribosomal protein S5 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsE PE=3 SV=1 335 491 1.0E-09
sp|Q6LV99|RS5_PHOPR 30S ribosomal protein S5 OS=Photobacterium profundum GN=rpsE PE=3 SV=1 340 491 1.0E-09
sp|Q0BYD1|RS5_HYPNA 30S ribosomal protein S5 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsE PE=3 SV=1 312 491 1.0E-09
sp|Q2GH39|RS5_EHRCR 30S ribosomal protein S5 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpsE PE=3 SV=1 345 491 1.0E-09
sp|Q7VQD1|RS5_BLOFL 30S ribosomal protein S5 OS=Blochmannia floridanus GN=rpsE PE=3 SV=1 333 488 1.0E-09
sp|Q488Z6|RS5_COLP3 30S ribosomal protein S5 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsE PE=3 SV=1 340 488 2.0E-09
sp|A6VLK5|RS5_ACTSZ 30S ribosomal protein S5 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsE PE=3 SV=1 340 491 2.0E-09
sp|B7GNC3|RS5_BIFLS 30S ribosomal protein S5 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rpsE PE=3 SV=1 335 491 2.0E-09
sp|B3DQD1|RS5_BIFLD 30S ribosomal protein S5 OS=Bifidobacterium longum (strain DJO10A) GN=rpsE PE=3 SV=1 335 491 2.0E-09
sp|A1JS11|RS5_YERE8 30S ribosomal protein S5 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsE PE=3 SV=1 340 491 2.0E-09
sp|P59122|RS5_BIFLO 30S ribosomal protein S5 OS=Bifidobacterium longum (strain NCC 2705) GN=rpsE PE=3 SV=1 335 491 3.0E-09
sp|Q1R0F8|RS5_CHRSD 30S ribosomal protein S5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsE PE=3 SV=1 342 491 3.0E-09
sp|Q664T8|RS5_YERPS 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsE PE=3 SV=1 340 491 3.0E-09
sp|A4TH09|RS5_YERPP 30S ribosomal protein S5 OS=Yersinia pestis (strain Pestoides F) GN=rpsE PE=3 SV=1 340 491 3.0E-09
sp|Q1CCW1|RS5_YERPN 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsE PE=3 SV=1 340 491 3.0E-09
sp|Q8ZJ95|RS5_YERPE 30S ribosomal protein S5 OS=Yersinia pestis GN=rpsE PE=3 SV=1 340 491 3.0E-09
sp|Q1C2W4|RS5_YERPA 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsE PE=3 SV=1 340 491 3.0E-09
sp|A7FNL7|RS5_YERP3 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsE PE=3 SV=1 340 491 3.0E-09
sp|A0M581|RS5_GRAFK 30S ribosomal protein S5 OS=Gramella forsetii (strain KT0803) GN=rpsE PE=3 SV=1 339 497 3.0E-09
sp|A6U876|RS5_SINMW 30S ribosomal protein S5 OS=Sinorhizobium medicae (strain WSM419) GN=rpsE PE=3 SV=1 340 487 3.0E-09
sp|Q92QF3|RS5_RHIME 30S ribosomal protein S5 OS=Rhizobium meliloti (strain 1021) GN=rpsE PE=3 SV=1 340 487 3.0E-09
sp|Q2S929|RS5_HAHCH 30S ribosomal protein S5 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsE PE=3 SV=1 342 491 3.0E-09
sp|A8GKI0|RS5_SERP5 30S ribosomal protein S5 OS=Serratia proteamaculans (strain 568) GN=rpsE PE=3 SV=1 340 491 4.0E-09
sp|B6EPU2|RS5_ALISL 30S ribosomal protein S5 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsE PE=3 SV=1 340 485 5.0E-09
sp|Q15X56|RS5_PSEA6 30S ribosomal protein S5 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsE PE=3 SV=1 337 491 5.0E-09
sp|Q5LW41|RS5_RUEPO 30S ribosomal protein S5 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsE PE=3 SV=1 339 491 5.0E-09
sp|A1T0C5|RS5_PSYIN 30S ribosomal protein S5 OS=Psychromonas ingrahamii (strain 37) GN=rpsE PE=3 SV=1 340 485 5.0E-09
sp|Q21QP0|RS5_RHOFT 30S ribosomal protein S5 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsE PE=3 SV=1 335 488 5.0E-09
sp|A1VJ32|RS5_POLNA 30S ribosomal protein S5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsE PE=3 SV=1 335 491 5.0E-09
sp|A7IPQ3|RS5_XANP2 30S ribosomal protein S5 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsE PE=3 SV=1 342 488 6.0E-09
sp|Q16AC7|RS5_ROSDO 30S ribosomal protein S5 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsE PE=3 SV=1 339 491 6.0E-09
sp|B5FG26|RS5_VIBFM 30S ribosomal protein S5 OS=Vibrio fischeri (strain MJ11) GN=rpsE PE=3 SV=1 340 485 6.0E-09
sp|Q5E897|RS5_VIBF1 30S ribosomal protein S5 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsE PE=3 SV=1 340 485 6.0E-09
sp|B5ELZ6|RS5_ACIF5 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsE PE=3 SV=1 335 492 6.0E-09
sp|B7J484|RS5_ACIF2 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsE PE=3 SV=1 335 492 6.0E-09
sp|Q0ANR7|RS5_MARMM 30S ribosomal protein S5 OS=Maricaulis maris (strain MCS10) GN=rpsE PE=3 SV=1 342 491 6.0E-09
sp|B9KLA8|RS5_RHOSK 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsE PE=3 SV=1 339 493 7.0E-09
sp|Q3J5Q5|RS5_RHOS4 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsE PE=3 SV=1 339 493 7.0E-09
sp|A3PGM8|RS5_RHOS1 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsE PE=3 SV=1 339 493 7.0E-09
sp|Q31IW5|RS5_THICR 30S ribosomal protein S5 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsE PE=3 SV=1 335 488 7.0E-09
sp|Q5HAT9|RS5_EHRRW 30S ribosomal protein S5 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpsE PE=3 SV=1 345 488 7.0E-09
sp|Q5FFR5|RS5_EHRRG 30S ribosomal protein S5 OS=Ehrlichia ruminantium (strain Gardel) GN=rpsE PE=3 SV=2 345 488 7.0E-09
sp|B4RT45|RS5_ALTMD 30S ribosomal protein S5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsE PE=3 SV=1 340 491 7.0E-09
sp|A6TEV5|RS5_KLEP7 30S ribosomal protein S5 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsE PE=3 SV=1 340 491 8.0E-09
sp|B8DW30|RS5_BIFA0 30S ribosomal protein S5 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpsE PE=3 SV=1 333 491 9.0E-09
sp|A8LM74|RS5_DINSH 30S ribosomal protein S5 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsE PE=3 SV=1 339 493 1.0E-08
sp|A4VHP7|RS5_PSEU5 30S ribosomal protein S5 OS=Pseudomonas stutzeri (strain A1501) GN=rpsE PE=3 SV=1 338 491 1.0E-08
sp|C3MAZ7|RS5_RHISN 30S ribosomal protein S5 OS=Rhizobium sp. (strain NGR234) GN=rpsE PE=3 SV=1 340 499 1.0E-08
sp|A4YSK9|RS5_BRASO 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsE PE=3 SV=2 342 498 2.0E-08
sp|A5ELL0|RS5_BRASB 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsE PE=3 SV=1 342 498 2.0E-08
sp|Q057C1|RS5_BUCCC 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsE PE=3 SV=1 340 486 2.0E-08
sp|B8ELE6|RS5_METSB 30S ribosomal protein S5 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsE PE=3 SV=1 328 481 2.0E-08
sp|Q07KN5|RS5_RHOP5 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsE PE=3 SV=1 342 498 2.0E-08
sp|Q1QDG9|RS5_PSYCK 30S ribosomal protein S5 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsE PE=3 SV=1 337 488 2.0E-08
sp|Q4FUD9|RS5_PSYA2 30S ribosomal protein S5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsE PE=3 SV=1 337 488 2.0E-08
sp|Q8D1Z5|RS5_WIGBR 30S ribosomal protein S5 OS=Wigglesworthia glossinidia brevipalpis GN=rpsE PE=3 SV=1 334 491 2.0E-08
sp|Q9PE59|RS5_XYLFA 30S ribosomal protein S5 OS=Xylella fastidiosa (strain 9a5c) GN=rpsE PE=3 SV=1 335 497 2.0E-08
sp|A5V5Y5|RS5_SPHWW 30S ribosomal protein S5 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsE PE=3 SV=1 335 491 2.0E-08
sp|Q211G5|RS5_RHOPB 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsE PE=3 SV=1 342 498 2.0E-08
sp|A3M967|RS5_ACIBT 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsE PE=3 SV=2 335 492 2.0E-08
sp|B0V6W2|RS5_ACIBY 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AYE) GN=rpsE PE=3 SV=1 335 492 2.0E-08
sp|B0VQT5|RS5_ACIBS 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain SDF) GN=rpsE PE=3 SV=1 335 492 2.0E-08
sp|B2HZ91|RS5_ACIBC 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain ACICU) GN=rpsE PE=3 SV=1 335 492 2.0E-08
sp|B7IA22|RS5_ACIB5 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AB0057) GN=rpsE PE=3 SV=1 335 492 2.0E-08
sp|B7GW19|RS5_ACIB3 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsE PE=3 SV=1 335 492 2.0E-08
sp|A4WVJ1|RS5_RHOS5 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsE PE=3 SV=1 339 493 2.0E-08
sp|Q2GL42|RS5_ANAPZ 30S ribosomal protein S5 OS=Anaplasma phagocytophilum (strain HZ) GN=rpsE PE=3 SV=1 354 491 3.0E-08
sp|Q89JA1|RS5_BRADU 30S ribosomal protein S5 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsE PE=3 SV=1 342 498 3.0E-08
sp|B1LWQ9|RS5_METRJ 30S ribosomal protein S5 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsE PE=3 SV=1 342 488 3.0E-08
sp|B8G6Q8|RS5_CHLAD 30S ribosomal protein S5 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsE PE=3 SV=1 339 481 3.0E-08
sp|A6X0D5|RS5_OCHA4 30S ribosomal protein S5 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsE PE=3 SV=1 342 487 3.0E-08
sp|B1Z776|RS5_METPB 30S ribosomal protein S5 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsE PE=3 SV=1 342 488 3.0E-08
sp|B0U5L6|RS5_XYLFM 30S ribosomal protein S5 OS=Xylella fastidiosa (strain M12) GN=rpsE PE=3 SV=1 335 490 3.0E-08
sp|Q1GK12|RS5_RUEST 30S ribosomal protein S5 OS=Ruegeria sp. (strain TM1040) GN=rpsE PE=3 SV=1 339 491 4.0E-08
sp|A9W4S3|RS5_METEP 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain PA1) GN=rpsE PE=3 SV=1 342 488 4.0E-08
sp|B7L0T3|RS5_METC4 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsE PE=3 SV=1 342 488 4.0E-08
sp|Q4ZMR1|RS5_PSEU2 30S ribosomal protein S5 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsE PE=3 SV=1 338 491 4.0E-08
sp|Q889V4|RS5_PSESM 30S ribosomal protein S5 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsE PE=3 SV=1 338 491 4.0E-08
sp|Q3J8T1|RS5_NITOC 30S ribosomal protein S5 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsE PE=3 SV=1 324 491 4.0E-08
sp|Q2LQC0|RS5_SYNAS 30S ribosomal protein S5 OS=Syntrophus aciditrophicus (strain SB) GN=rpsE PE=3 SV=1 330 491 4.0E-08
sp|Q605C9|RS5_METCA 30S ribosomal protein S5 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsE PE=3 SV=1 335 485 5.0E-08
sp|Q48D53|RS5_PSE14 30S ribosomal protein S5 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsE PE=3 SV=1 338 491 5.0E-08
sp|Q1IFU9|RS5_PSEE4 30S ribosomal protein S5 OS=Pseudomonas entomophila (strain L48) GN=rpsE PE=3 SV=1 338 491 5.0E-08
sp|Q5PA75|RS5_ANAMM 30S ribosomal protein S5 OS=Anaplasma marginale (strain St. Maries) GN=rpsE PE=3 SV=1 354 491 5.0E-08
sp|B9KJ53|RS5_ANAMF 30S ribosomal protein S5 OS=Anaplasma marginale (strain Florida) GN=rpsE PE=3 SV=1 354 491 5.0E-08
sp|Q3IJK2|RS5_PSEHT 30S ribosomal protein S5 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsE PE=3 SV=1 340 488 6.0E-08
sp|A4G9S1|RS5_HERAR 30S ribosomal protein S5 OS=Herminiimonas arsenicoxydans GN=rpsE PE=3 SV=1 340 491 6.0E-08
sp|Q8UE35|RS5_AGRFC 30S ribosomal protein S5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsE PE=3 SV=1 340 487 6.0E-08
sp|B1JAJ5|RS5_PSEPW 30S ribosomal protein S5 OS=Pseudomonas putida (strain W619) GN=rpsE PE=3 SV=1 338 491 6.0E-08
sp|Q88QL8|RS5_PSEPK 30S ribosomal protein S5 OS=Pseudomonas putida (strain KT2440) GN=rpsE PE=3 SV=1 338 491 6.0E-08
sp|B0KK84|RS5_PSEPG 30S ribosomal protein S5 OS=Pseudomonas putida (strain GB-1) GN=rpsE PE=3 SV=1 338 491 6.0E-08
sp|A5VXR4|RS5_PSEP1 30S ribosomal protein S5 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsE PE=3 SV=1 338 491 6.0E-08
sp|Q98N40|RS5_RHILO 30S ribosomal protein S5 OS=Rhizobium loti (strain MAFF303099) GN=rpsE PE=3 SV=2 342 487 6.0E-08
sp|Q749A4|RS5_GEOSL 30S ribosomal protein S5 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsE PE=3 SV=1 340 485 6.0E-08
sp|A4IZR7|RS5_FRATW 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsE PE=3 SV=1 335 492 7.0E-08
sp|Q5NHV1|RS5_FRATT 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsE PE=3 SV=1 335 492 7.0E-08
sp|Q0BNR0|RS5_FRATO 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsE PE=3 SV=1 335 492 7.0E-08
sp|A0Q4K0|RS5_FRATN 30S ribosomal protein S5 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsE PE=3 SV=1 335 492 7.0E-08
sp|A7N9U2|RS5_FRATF 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsE PE=3 SV=1 335 492 7.0E-08
sp|Q14JA3|RS5_FRAT1 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsE PE=3 SV=1 335 492 7.0E-08
sp|B9JVQ4|RS5_AGRVS 30S ribosomal protein S5 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsE PE=3 SV=1 340 487 7.0E-08
sp|A4XZ73|RS5_PSEMY 30S ribosomal protein S5 OS=Pseudomonas mendocina (strain ymp) GN=rpsE PE=3 SV=1 338 491 7.0E-08
sp|Q1MIC4|RS5_RHIL3 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsE PE=3 SV=1 340 487 8.0E-08
sp|Q1QN13|RS5_NITHX 30S ribosomal protein S5 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsE PE=3 SV=1 342 498 8.0E-08
sp|B5ZYV2|RS5_RHILW 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsE PE=3 SV=1 340 487 8.0E-08
sp|Q2K9J9|RS5_RHIEC 30S ribosomal protein S5 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsE PE=3 SV=1 340 487 8.0E-08
sp|B3PWT8|RS5_RHIE6 30S ribosomal protein S5 OS=Rhizobium etli (strain CIAT 652) GN=rpsE PE=3 SV=1 340 487 8.0E-08
sp|Q4K550|RS5_PSEF5 30S ribosomal protein S5 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsE PE=3 SV=1 338 491 9.0E-08
sp|Q2A5F3|RS5_FRATH 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsE PE=3 SV=1 335 492 9.0E-08
sp|P66571|RS5_BRUSU 30S ribosomal protein S5 OS=Brucella suis biovar 1 (strain 1330) GN=rpsE PE=3 SV=1 342 487 9.0E-08
sp|B0CH15|RS5_BRUSI 30S ribosomal protein S5 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsE PE=3 SV=1 342 487 9.0E-08
sp|P66570|RS5_BRUME 30S ribosomal protein S5 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsE PE=3 SV=1 342 487 9.0E-08
sp|C0RJI4|RS5_BRUMB 30S ribosomal protein S5 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsE PE=3 SV=1 342 487 9.0E-08
sp|A9M5N3|RS5_BRUC2 30S ribosomal protein S5 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsE PE=3 SV=1 342 487 9.0E-08
sp|Q57CS5|RS5_BRUAB 30S ribosomal protein S5 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsE PE=3 SV=1 342 487 9.0E-08
sp|Q2YRT3|RS5_BRUA2 30S ribosomal protein S5 OS=Brucella abortus (strain 2308) GN=rpsE PE=3 SV=1 342 487 9.0E-08
sp|B2S662|RS5_BRUA1 30S ribosomal protein S5 OS=Brucella abortus (strain S19) GN=rpsE PE=3 SV=1 342 487 9.0E-08
sp|Q2L266|RS5_BORA1 30S ribosomal protein S5 OS=Bordetella avium (strain 197N) GN=rpsE PE=3 SV=1 340 491 1.0E-07
sp|Q1GPB6|RS5_SPHAL 30S ribosomal protein S5 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsE PE=3 SV=1 335 493 1.0E-07
sp|Q6F7S9|RS5_ACIAD 30S ribosomal protein S5 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsE PE=3 SV=1 335 485 1.0E-07
sp|A6GZ82|RS5_FLAPJ 30S ribosomal protein S5 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsE PE=3 SV=1 339 497 1.0E-07
sp|B2T734|RS5_BURPP 30S ribosomal protein S5 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsE PE=3 SV=1 335 491 1.0E-07
sp|Q47J86|RS5_DECAR 30S ribosomal protein S5 OS=Dechloromonas aromatica (strain RCB) GN=rpsE PE=3 SV=1 340 485 1.0E-07
sp|Q3K605|RS5_PSEPF 30S ribosomal protein S5 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsE PE=3 SV=1 338 492 1.0E-07
sp|A5VQY9|RS5_BRUO2 30S ribosomal protein S5 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsE PE=3 SV=1 342 487 1.0E-07
sp|Q3SSU9|RS5_NITWN 30S ribosomal protein S5 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsE PE=3 SV=1 342 498 1.0E-07
sp|Q87E65|RS5_XYLFT 30S ribosomal protein S5 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsE PE=3 SV=1 335 490 2.0E-07
sp|B2I8I6|RS5_XYLF2 30S ribosomal protein S5 OS=Xylella fastidiosa (strain M23) GN=rpsE PE=3 SV=1 335 490 2.0E-07
sp|Q9HWF2|RS5_PSEAE 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsE PE=3 SV=1 338 491 2.0E-07
sp|Q02T63|RS5_PSEAB 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsE PE=3 SV=1 338 491 2.0E-07
sp|B7V661|RS5_PSEA8 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsE PE=3 SV=1 338 491 2.0E-07
sp|A6UZK5|RS5_PSEA7 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsE PE=3 SV=1 338 491 2.0E-07
sp|A1TYL4|RS5_MARHV 30S ribosomal protein S5 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsE PE=3 SV=1 342 491 2.0E-07
sp|Q89A82|RS5_BUCBP 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsE PE=3 SV=2 340 489 2.0E-07
sp|C1B029|RS5_RHOOB 30S ribosomal protein S5 OS=Rhodococcus opacus (strain B4) GN=rpsE PE=3 SV=1 337 491 2.0E-07
sp|Q0S3F9|RS5_RHOJR 30S ribosomal protein S5 OS=Rhodococcus jostii (strain RHA1) GN=rpsE PE=3 SV=1 337 491 2.0E-07
sp|Q6ME47|RS5_PARUW 30S ribosomal protein S5 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsE PE=3 SV=1 337 485 2.0E-07
sp|A4JAQ7|RS5_BURVG 30S ribosomal protein S5 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsE PE=3 SV=1 335 491 2.0E-07
sp|Q0BJ29|RS5_BURCM 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsE PE=3 SV=1 335 491 2.0E-07
sp|A0K3P2|RS5_BURCH 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsE PE=3 SV=1 335 491 2.0E-07
sp|B1JU39|RS5_BURCC 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsE PE=3 SV=1 335 491 2.0E-07
sp|Q1BRW5|RS5_BURCA 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsE PE=3 SV=1 335 491 2.0E-07
sp|B1YRP6|RS5_BURA4 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsE PE=3 SV=1 335 491 2.0E-07
sp|Q0BUN3|RS5_GRABC 30S ribosomal protein S5 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsE PE=3 SV=1 337 491 2.0E-07
sp|B2JI48|RS5_BURP8 30S ribosomal protein S5 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsE PE=3 SV=1 335 491 2.0E-07
sp|C5CQ83|RS5_VARPS 30S ribosomal protein S5 OS=Variovorax paradoxus (strain S110) GN=rpsE PE=3 SV=1 340 485 2.0E-07
sp|B6JEY2|RS5_OLICO 30S ribosomal protein S5 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsE PE=3 SV=1 342 481 2.0E-07
sp|Q2G8W3|RS5_NOVAD 30S ribosomal protein S5 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsE PE=3 SV=1 335 491 2.0E-07
sp|A1B044|RS5_PARDP 30S ribosomal protein S5 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsE PE=3 SV=1 339 491 2.0E-07
sp|Q13TI7|RS5_BURXL 30S ribosomal protein S5 OS=Burkholderia xenovorans (strain LB400) GN=rpsE PE=3 SV=1 335 491 2.0E-07
sp|C1DKN0|RS5_AZOVD 30S ribosomal protein S5 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsE PE=3 SV=1 338 491 2.0E-07
sp|B9LJE9|RS5_CHLSY 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsE PE=3 SV=1 342 481 2.0E-07
sp|A9WH83|RS5_CHLAA 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsE PE=3 SV=1 342 481 2.0E-07
sp|Q0VSI6|RS5_ALCBS 30S ribosomal protein S5 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsE PE=3 SV=1 342 488 3.0E-07
sp|C3K2V9|RS5_PSEFS 30S ribosomal protein S5 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsE PE=3 SV=1 338 485 3.0E-07
sp|A1AVL7|RS5_RUTMC 30S ribosomal protein S5 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsE PE=3 SV=1 345 488 3.0E-07
sp|Q2IXP3|RS5_RHOP2 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsE PE=3 SV=1 342 498 5.0E-07
sp|B8ISA2|RS5_METNO 30S ribosomal protein S5 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsE PE=3 SV=1 335 488 5.0E-07
sp|P46183|RS5_BUCAK 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rpsE PE=3 SV=2 340 491 5.0E-07
sp|Q134U6|RS5_RHOPS 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsE PE=3 SV=1 342 498 5.0E-07
sp|A0PM82|RS5_MYCUA 30S ribosomal protein S5 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsE PE=3 SV=1 340 491 5.0E-07
sp|P9WH33|RS5_MYCTU 30S ribosomal protein S5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsE PE=1 SV=1 340 491 5.0E-07
sp|P9WH32|RS5_MYCTO 30S ribosomal protein S5 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsE PE=3 SV=1 340 491 5.0E-07
sp|A5U0A7|RS5_MYCTA 30S ribosomal protein S5 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsE PE=3 SV=1 340 491 5.0E-07
sp|C1AL55|RS5_MYCBT 30S ribosomal protein S5 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpsE PE=3 SV=1 340 491 5.0E-07
sp|A1KGK2|RS5_MYCBP 30S ribosomal protein S5 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpsE PE=3 SV=1 340 491 5.0E-07
sp|P66575|RS5_MYCBO 30S ribosomal protein S5 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsE PE=3 SV=1 340 491 5.0E-07
sp|Q6FZD9|RS5_BARQU 30S ribosomal protein S5 OS=Bartonella quintana (strain Toulouse) GN=rpsE PE=3 SV=1 335 487 6.0E-07
sp|Q5Z1Q5|RS5_NOCFA 30S ribosomal protein S5 OS=Nocardia farcinica (strain IFM 10152) GN=rpsE PE=3 SV=1 333 491 6.0E-07
sp|Q6A6P3|RS5_PROAC 30S ribosomal protein S5 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpsE PE=3 SV=1 335 491 6.0E-07
sp|Q0ABF8|RS5_ALKEH 30S ribosomal protein S5 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsE PE=3 SV=1 335 491 6.0E-07
sp|B2HCT8|RS5_MYCMM 30S ribosomal protein S5 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsE PE=3 SV=1 340 491 7.0E-07
sp|Q63Q28|RS5_BURPS 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain K96243) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|A3NEG2|RS5_BURP6 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 668) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|Q3JMT0|RS5_BURP1 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|A3P096|RS5_BURP0 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|A1V886|RS5_BURMS 30S ribosomal protein S5 OS=Burkholderia mallei (strain SAVP1) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|Q62GM2|RS5_BURMA 30S ribosomal protein S5 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|A2S7J3|RS5_BURM9 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|A3MRX1|RS5_BURM7 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|A9ADL0|RS5_BURM1 30S ribosomal protein S5 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|Q39KF0|RS5_BURL3 30S ribosomal protein S5 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|B4E5D7|RS5_BURCJ 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsE PE=3 SV=1 335 491 7.0E-07
sp|Q8EUD0|RS5_MYCPE 30S ribosomal protein S5 OS=Mycoplasma penetrans (strain HF-2) GN=rpsE PE=3 SV=1 334 491 7.0E-07
sp|B3QBW3|RS5_RHOPT 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsE PE=3 SV=1 342 498 7.0E-07
sp|Q6N4V0|RS5_RHOPA 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsE PE=1 SV=3 342 498 7.0E-07
sp|Q11HR9|RS5_CHESB 30S ribosomal protein S5 OS=Chelativorans sp. (strain BNC1) GN=rpsE PE=3 SV=1 342 487 8.0E-07
sp|A8LB15|RS5_FRASN 30S ribosomal protein S5 OS=Frankia sp. (strain EAN1pec) GN=rpsE PE=3 SV=1 337 491 8.0E-07
sp|A5USH2|RS5_ROSS1 30S ribosomal protein S5 OS=Roseiflexus sp. (strain RS-1) GN=rpsE PE=3 SV=1 323 485 8.0E-07
sp|A1USR1|RS5_BARBK 30S ribosomal protein S5 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsE PE=3 SV=1 312 487 8.0E-07
sp|Q0RRQ4|RS5_FRAAA 30S ribosomal protein S5 OS=Frankia alni (strain ACN14a) GN=rpsE PE=3 SV=1 337 491 8.0E-07
sp|Q2JFF9|RS5_FRASC 30S ribosomal protein S5 OS=Frankia sp. (strain CcI3) GN=rpsE PE=3 SV=1 337 491 8.0E-07
sp|Q2SU44|RS5_BURTA 30S ribosomal protein S5 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsE PE=3 SV=1 335 491 9.0E-07
sp|B2IK79|RS5_BEII9 30S ribosomal protein S5 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsE PE=3 SV=1 335 498 9.0E-07
sp|B0UHV2|RS5_METS4 30S ribosomal protein S5 OS=Methylobacterium sp. (strain 4-46) GN=rpsE PE=3 SV=1 342 488 1.0E-06
sp|A9IW04|RS5_BART1 30S ribosomal protein S5 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsE PE=3 SV=1 335 491 1.0E-06
sp|A5CXM1|RS5_VESOH 30S ribosomal protein S5 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpsE PE=3 SV=1 333 485 1.0E-06
sp|Q73S92|RS5_MYCPA 30S ribosomal protein S5 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsE PE=3 SV=1 340 491 1.0E-06
sp|A5WCK7|RS5_PSYWF 30S ribosomal protein S5 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsE PE=3 SV=1 347 488 1.0E-06
sp|A1RWR6|RS5_THEPD 30S ribosomal protein S5 OS=Thermofilum pendens (strain Hrk 5) GN=rps5 PE=3 SV=1 340 471 1.0E-06
sp|Q39XY9|RS5_GEOMG 30S ribosomal protein S5 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsE PE=3 SV=1 340 485 1.0E-06
sp|A9H3L2|RS5_GLUDA 30S ribosomal protein S5 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsE PE=3 SV=1 340 491 1.0E-06
sp|A6T3I7|RS5_JANMA 30S ribosomal protein S5 OS=Janthinobacterium sp. (strain Marseille) GN=rpsE PE=3 SV=1 340 491 1.0E-06
sp|A0QSG6|RS5_MYCS2 30S ribosomal protein S5 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsE PE=1 SV=1 337 491 1.0E-06
sp|A1ALV8|RS5_PELPD 30S ribosomal protein S5 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsE PE=3 SV=1 339 485 2.0E-06
sp|B1LBM3|RS5_THESQ 30S ribosomal protein S5 OS=Thermotoga sp. (strain RQ2) GN=rpsE PE=3 SV=1 345 481 2.0E-06
sp|A5IMA0|RS5_THEP1 30S ribosomal protein S5 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsE PE=3 SV=1 345 481 2.0E-06
sp|Q8A493|RS5_BACTN 30S ribosomal protein S5 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsE PE=3 SV=1 339 497 2.0E-06
sp|Q9X1J2|RS5_THEMA 30S ribosomal protein S5 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsE PE=3 SV=1 345 481 2.0E-06
sp|A0L5Z0|RS5_MAGMM 30S ribosomal protein S5 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsE PE=3 SV=1 333 492 3.0E-06
sp|Q6AD11|RS5_LEIXX 30S ribosomal protein S5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpsE PE=3 SV=1 339 485 3.0E-06
sp|A0RUE7|RS5_CENSY 30S ribosomal protein S5 OS=Cenarchaeum symbiosum (strain A) GN=rps5 PE=3 SV=1 342 474 3.0E-06
sp|Q85FU7|RR5_CYAME 30S ribosomal protein S5, chloroplastic OS=Cyanidioschyzon merolae GN=rps5 PE=3 SV=1 335 471 4.0E-06
sp|A4TED4|RS5_MYCGI 30S ribosomal protein S5 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpsE PE=3 SV=1 340 491 5.0E-06
sp|C0QQP0|RS5_PERMH 30S ribosomal protein S5 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsE PE=3 SV=1 340 495 5.0E-06
sp|Q6G2Y2|RS5_BARHE 30S ribosomal protein S5 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsE PE=3 SV=1 333 487 5.0E-06
sp|A9IHT0|RS5_BORPD 30S ribosomal protein S5 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsE PE=3 SV=1 340 491 5.0E-06
sp|P47414|RS5_MYCGE 30S ribosomal protein S5 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsE PE=3 SV=1 340 491 5.0E-06
sp|A1WVA5|RS5_HALHL 30S ribosomal protein S5 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsE PE=3 SV=1 340 491 5.0E-06
sp|Q46WG1|RS5_CUPPJ 30S ribosomal protein S5 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsE PE=3 SV=1 335 491 5.0E-06
sp|Q5WZJ5|RS5_LEGPL 30S ribosomal protein S5 OS=Legionella pneumophila (strain Lens) GN=rpsE PE=3 SV=1 319 491 6.0E-06
sp|Q5ZYM6|RS5_LEGPH 30S ribosomal protein S5 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsE PE=3 SV=1 319 491 6.0E-06
sp|A5IHP7|RS5_LEGPC 30S ribosomal protein S5 OS=Legionella pneumophila (strain Corby) GN=rpsE PE=3 SV=1 319 491 6.0E-06
sp|Q5X842|RS5_LEGPA 30S ribosomal protein S5 OS=Legionella pneumophila (strain Paris) GN=rpsE PE=3 SV=1 319 491 6.0E-06
sp|C3PL26|RS5_CORA7 30S ribosomal protein S5 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=rpsE PE=3 SV=1 337 491 6.0E-06
sp|Q68W95|RS5_RICTY 30S ribosomal protein S5 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsE PE=3 SV=1 341 491 6.0E-06
sp|Q7VTB4|RS5_BORPE 30S ribosomal protein S5 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsE PE=3 SV=1 340 491 6.0E-06
sp|Q7W2D8|RS5_BORPA 30S ribosomal protein S5 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsE PE=3 SV=1 340 491 6.0E-06
sp|Q7WRA6|RS5_BORBR 30S ribosomal protein S5 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsE PE=3 SV=1 340 491 6.0E-06
sp|A6LEH4|RS5_PARD8 30S ribosomal protein S5 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsE PE=3 SV=1 339 497 6.0E-06
sp|C4LL09|RS5_CORK4 30S ribosomal protein S5 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpsE PE=3 SV=1 337 491 7.0E-06
sp|B1Y8C0|RS5_LEPCP 30S ribosomal protein S5 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsE PE=3 SV=1 338 485 7.0E-06
sp|Q7UN03|RS5_RHOBA 30S ribosomal protein S5 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsE PE=3 SV=1 354 485 7.0E-06
sp|Q64NM5|RS5_BACFR 30S ribosomal protein S5 OS=Bacteroides fragilis (strain YCH46) GN=rpsE PE=3 SV=1 333 497 7.0E-06
sp|Q5L8C6|RS5_BACFN 30S ribosomal protein S5 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsE PE=3 SV=1 333 497 7.0E-06
sp|Q9UX87|RS5_SULSO 30S ribosomal protein S5 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps5 PE=3 SV=2 347 473 8.0E-06
sp|Q661C5|RS5_BORBP 30S ribosomal protein S5 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsE PE=3 SV=1 340 487 8.0E-06
sp|C0ZW43|RS5_RHOE4 30S ribosomal protein S5 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpsE PE=3 SV=1 337 491 9.0E-06
sp|B3R7F1|RS5_CUPTR 30S ribosomal protein S5 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsE PE=3 SV=1 335 491 9.0E-06
sp|Q0K636|RS5_CUPNH 30S ribosomal protein S5 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsE PE=3 SV=1 335 491 9.0E-06
sp|B2UEK2|RS5_RALPJ 30S ribosomal protein S5 OS=Ralstonia pickettii (strain 12J) GN=rpsE PE=3 SV=1 335 491 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0003723 RNA binding Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0005488 binding No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:1990904 ribonucleoprotein complex No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4046
MRLARPAHSLLGRCLSSTRAATPLVPCRRPFQTSAPRAKRRPRFRNVKAEELGLLEPSKMAEYRRDKFPEYSDEE
KAELRRLYNAQQVEAIEAGEQAVKPEDLVIQGRLRDDAYAPNYMDDFATLDPRYDVKPEMEVTPREPVWLNHDDW
VDKYGKKMLDLTQEKTSDQLKRAMVRALRRVKDSDGQEELIDLTDEELDELEKDPDLLRKYIVEEEEEGKKGDGP
PKPAAEADLTAGQMARLDKALDAAWNKEVDLMAKEAEDSVELKPTALELRADGPAGAERVYSAEAHELGKVPGVA
GLYNISSSDKDRDRDDTGSFDEIKRLTGFDLVEIESIYRKVLVQRNVSNQTRLGKVRSSSILAIAGNGNGWLGLG
SAKSTDLQVAIVTAQFLAIRNMKPIRRYEKRTIYGNVKAKVSGTIVELFARPPGFGLRCPHRIFEMCRASGLHDI
SARMPRSKNPMNSVKAAYQALLNQPDPEEIAIGRGRKLVDVRKVYYGGAVL*
Coding >Hirsu2|4046
ATGAGGCTCGCACGCCCGGCGCACAGCCTCCTCGGCCGCTGCCTTTCGTCGACGCGAGCTGCGACGCCCCTGGTG
CCGTGTCGGCGGCCGTTCCAGACGTCGGCGCCACGTGCGAAGCGGCGGCCGCGATTCCGCAATGTCAAGGCCGAG
GAGCTGGGCTTGCTGGAGCCGTCCAAGATGGCGGAGTATCGGCGGGACAAGTTCCCCGAGTACTCGGACGAGGAG
AAGGCCGAGCTGCGGCGCCTCTACAACGCGCAGCAGGTCGAGGCCATCGAGGCCGGTGAGCAGGCGGTCAAGCCC
GAGGACCTGGTAATCCAGGGCCGGCTGCGCGACGACGCCTATGCGCCTAACTACATGGACGACTTCGCGACGCTG
GACCCGCGGTACGACGTCAAGCCAGAGATGGAGGTGACGCCGCGGGAGCCCGTCTGGCTCAACCACGACGACTGG
GTCGACAAGTACGGCAAGAAGATGCTGGACCTGACGCAGGAGAAGACGAGCGACCAGCTCAAGAGGGCCATGGTC
CGGGCGCTGCGGAGGGTCAAGGACAGCGACGGCCAGGAGGAGCTGATCGACCTCACGGACGAGGAGCTGGACGAG
CTGGAAAAGGACCCGGACCTGCTCAGGAAGTACATTGTGGAGGAGGAGGAGGAGGGGAAGAAGGGCGACGGGCCC
CCGAAACCGGCCGCCGAGGCCGACCTCACGGCCGGGCAGATGGCGAGGCTGGATAAGGCCCTCGACGCGGCGTGG
AACAAGGAGGTGGACCTGATGGCCAAGGAGGCCGAGGACAGCGTCGAGCTGAAGCCGACGGCCCTGGAGCTGCGC
GCTGACGGCCCCGCGGGCGCCGAGCGCGTCTACTCGGCCGAGGCGCACGAGCTGGGCAAGGTGCCCGGCGTGGCG
GGCCTGTACAACATCAGCTCGTCGGACAAGGACCGCGACCGGGACGACACGGGCAGCTTCGACGAGATCAAGCGG
CTGACGGGCTTCGACCTGGTCGAGATCGAGTCCATCTACCGCAAGGTGCTCGTGCAGCGCAACGTCTCGAACCAG
ACGCGGCTGGGCAAGGTGCGCAGCTCCTCCATCCTGGCCATCGCCGGCAACGGCAACGGCTGGCTGGGGCTGGGC
AGCGCCAAGTCGACCGACCTGCAGGTCGCCATCGTGACGGCGCAGTTCCTGGCCATCCGCAACATGAAGCCCATC
CGCCGCTACGAGAAGCGCACCATCTACGGCAACGTCAAGGCCAAGGTCTCGGGCACCATTGTCGAGCTGTTTGCC
CGCCCGCCCGGGTTCGGCCTCCGCTGCCCGCACCGCATCTTCGAGATGTGCCGCGCCTCGGGCCTGCACGACATC
TCGGCGCGCATGCCGCGGTCCAAGAACCCGATGAACTCGGTCAAGGCCGCCTACCAGGCGCTCCTGAACCAGCCG
GACCCGGAGGAGATCGCCATCGGCCGCGGCCGCAAGCTGGTGGACGTGCGCAAGGTGTACTACGGCGGCGCCGTG
CTCTGA
Transcript >Hirsu2|4046
ATGAGGCTCGCACGCCCGGCGCACAGCCTCCTCGGCCGCTGCCTTTCGTCGACGCGAGCTGCGACGCCCCTGGTG
CCGTGTCGGCGGCCGTTCCAGACGTCGGCGCCACGTGCGAAGCGGCGGCCGCGATTCCGCAATGTCAAGGCCGAG
GAGCTGGGCTTGCTGGAGCCGTCCAAGATGGCGGAGTATCGGCGGGACAAGTTCCCCGAGTACTCGGACGAGGAG
AAGGCCGAGCTGCGGCGCCTCTACAACGCGCAGCAGGTCGAGGCCATCGAGGCCGGTGAGCAGGCGGTCAAGCCC
GAGGACCTGGTAATCCAGGGCCGGCTGCGCGACGACGCCTATGCGCCTAACTACATGGACGACTTCGCGACGCTG
GACCCGCGGTACGACGTCAAGCCAGAGATGGAGGTGACGCCGCGGGAGCCCGTCTGGCTCAACCACGACGACTGG
GTCGACAAGTACGGCAAGAAGATGCTGGACCTGACGCAGGAGAAGACGAGCGACCAGCTCAAGAGGGCCATGGTC
CGGGCGCTGCGGAGGGTCAAGGACAGCGACGGCCAGGAGGAGCTGATCGACCTCACGGACGAGGAGCTGGACGAG
CTGGAAAAGGACCCGGACCTGCTCAGGAAGTACATTGTGGAGGAGGAGGAGGAGGGGAAGAAGGGCGACGGGCCC
CCGAAACCGGCCGCCGAGGCCGACCTCACGGCCGGGCAGATGGCGAGGCTGGATAAGGCCCTCGACGCGGCGTGG
AACAAGGAGGTGGACCTGATGGCCAAGGAGGCCGAGGACAGCGTCGAGCTGAAGCCGACGGCCCTGGAGCTGCGC
GCTGACGGCCCCGCGGGCGCCGAGCGCGTCTACTCGGCCGAGGCGCACGAGCTGGGCAAGGTGCCCGGCGTGGCG
GGCCTGTACAACATCAGCTCGTCGGACAAGGACCGCGACCGGGACGACACGGGCAGCTTCGACGAGATCAAGCGG
CTGACGGGCTTCGACCTGGTCGAGATCGAGTCCATCTACCGCAAGGTGCTCGTGCAGCGCAACGTCTCGAACCAG
ACGCGGCTGGGCAAGGTGCGCAGCTCCTCCATCCTGGCCATCGCCGGCAACGGCAACGGCTGGCTGGGGCTGGGC
AGCGCCAAGTCGACCGACCTGCAGGTCGCCATCGTGACGGCGCAGTTCCTGGCCATCCGCAACATGAAGCCCATC
CGCCGCTACGAGAAGCGCACCATCTACGGCAACGTCAAGGCCAAGGTCTCGGGCACCATTGTCGAGCTGTTTGCC
CGCCCGCCCGGGTTCGGCCTCCGCTGCCCGCACCGCATCTTCGAGATGTGCCGCGCCTCGGGCCTGCACGACATC
TCGGCGCGCATGCCGCGGTCCAAGAACCCGATGAACTCGGTCAAGGCCGCCTACCAGGCGCTCCTGAACCAGCCG
GACCCGGAGGAGATCGCCATCGGCCGCGGCCGCAAGCTGGTGGACGTGCGCAAGGTGTACTACGGCGGCGCCGTG
CTCTGA
Gene >Hirsu2|4046
ATGAGGCTCGCACGCCCGGCGCACAGCCTCCTCGGCCGCTGCCTTTCGTCGACGCGAGCTGCGACGCCCCTGGTG
CCGTGTCGGCGGCCGTTCCAGACGTCGGCGCCACGTGCGAAGCGGCGGCCGCGATTCCGCAATGTCAAGGCCGAG
GAGCTGGGCTTGCTGGAGCCGTCCAAGATGGCGGAGTATCGGCGGGACAAGTTCCCCGAGTACTCGGACGAGGAG
AAGGCCGAGCTGCGGCGCCTCTACAACGCGCAGCAGGTCGAGGCCATCGAGGCCGGTGAGCAGGCGGTCAAGCCC
GAGGACCTGGTAATCCAGGGCCGGCTGCGCGACGACGCCTATGCGCCTAACTACATGGACGACTTCGCGACGCTG
GACCCGCGGTACGACGTCAAGCCAGAGATGGAGGTGACGCCGCGGGAGCCCGTCTGGCTCAACCACGACGACTGG
GTCGACAAGTACGGCAAGAAGATGCTGGACCTGACGCAGGAGAAGACGAGCGACCAGCTCAAGAGGGCCATGGTC
CGGGCGCTGCGGAGGGTCAAGGACAGCGACGGCCAGGAGGAGCTGATCGACCTCACGGACGAGGAGCTGGACGAG
CTGGAAAAGGACCCGGACCTGCTCAGGAAGTACATTGTGGAGGAGGAGGAGGAGGGGAAGAAGGGCGACGGGCCC
CCGAAACCGGCCGCCGAGGCCGACCTCACGGCCGGGCAGATGGCGAGGCTGGATAAGGCCCTCGACGCGGCGTGG
AACAAGGAGGTGGACCTGATGGCCAAGGAGGCCGAGGACAGCGTCGAGCTGAAGCCGACGGCCCTGGAGCTGCGC
GCTGACGGCCCCGCGGGCGCCGAGCGCGTCTACTCGGCCGAGGCGCACGAGCTGGGCAAGGTGCCCGGCGTGGCG
GGCCTGTACAACATCAGCTCGTCGGACAAGGACCGCGACCGGGACGACACGGGCAGCTTCGACGAGATCAAGCGG
CTGACGGGCTTCGACCTGGTCGAGATCGAGTCCATCTACCGCAAGGTGCTCGTGCAGCGCAACGTCTCGAACCAG
ACGCGGCTGGGCAAGGTGCGCAGCTCCTCCATCCTGGCCATCGCCGGCAACGGCAACGGCTGGCTGGGGCTGGGC
AGCGCCAAGTCGACCGACCTGCAGGTCGCCATCGTGACGGCGCAGTTCCTGGCCATCCGCAACATGAAGCCCATC
CGCCGCTACGAGAAGCGCACCATCTACGGCAACGTCAAGGCCAAGGTCTCGGGCACCATTGTCGAGCTGTTTGCC
CGCCCGCCCGGTGAGTCTTTCTTCCTTTCTTTTTTTTTGGGGGGGGGGCCCCAGCTCTGCGCCTCGACCGCTGCC
CCCTCTCCCTGCCCGCTTCCCGACGACTGACGGGCGCCATGCCTCGCGCAGGGTTCGGCCTCCGCTGCCCGCACC
GCATCTTCGAGATGTGCCGCGCCTCGGGCCTGCACGACATCTCGGCGCGCATGCCGCGGTCCAAGAACCCGATGA
ACTCGGTCAAGGCCGCCTACCAGGCGCTCCTGAACCAGCCGGACCCGGAGGAGATCGCCATCGGCCGCGGCCGCA
AGCTGGTGGACGTGCGCAAGGTGTACTACGGCGGCGCCGTGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail