Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4040
Gene name
LocationContig_21:38664..39734
Strand+
Gene length (bp)1070
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08221 HTH_9 RNA polymerase III subunit RPC82 helix-turn-helix domain 2.6E-14 9 69
PF05645 RNA_pol_Rpc82 RNA polymerase III subunit RPC82 3.3E-08 160 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZW7|RPC3_NEUCR DNA-directed RNA polymerase III subunit rpc-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpc-82 PE=3 SV=1 1 267 3.0E-46
sp|Q2GUW6|RPC3_CHAGB DNA-directed RNA polymerase III subunit RPC3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RPC82 PE=3 SV=1 47 267 7.0E-42
sp|Q1DTR6|RPC3_COCIM DNA-directed RNA polymerase III subunit RPC-3 OS=Coccidioides immitis (strain RS) GN=RPC-82 PE=3 SV=1 3 124 3.0E-28
sp|A6RPU8|RPC3_BOTFB DNA-directed RNA polymerase III subunit rpc3 OS=Botryotinia fuckeliana (strain B05.10) GN=rpc82 PE=3 SV=1 1 267 3.0E-28
sp|A2QUS7|RPC3_ASPNC DNA-directed RNA polymerase III subunit rpc3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rpc82 PE=3 SV=1 2 204 9.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZW7|RPC3_NEUCR DNA-directed RNA polymerase III subunit rpc-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpc-82 PE=3 SV=1 1 267 3.0E-46
sp|Q2GUW6|RPC3_CHAGB DNA-directed RNA polymerase III subunit RPC3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RPC82 PE=3 SV=1 47 267 7.0E-42
sp|Q1DTR6|RPC3_COCIM DNA-directed RNA polymerase III subunit RPC-3 OS=Coccidioides immitis (strain RS) GN=RPC-82 PE=3 SV=1 3 124 3.0E-28
sp|A6RPU8|RPC3_BOTFB DNA-directed RNA polymerase III subunit rpc3 OS=Botryotinia fuckeliana (strain B05.10) GN=rpc82 PE=3 SV=1 1 267 3.0E-28
sp|A2QUS7|RPC3_ASPNC DNA-directed RNA polymerase III subunit rpc3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rpc82 PE=3 SV=1 2 204 9.0E-25
sp|Q4WEU2|RPC3_ASPFU DNA-directed RNA polymerase III subunit rpc3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rpc82 PE=3 SV=1 2 204 9.0E-23
sp|A1C4R7|RPC3_ASPCL DNA-directed RNA polymerase III subunit rpc3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rpc82 PE=3 SV=1 2 204 5.0E-22
sp|A1CZP6|RPC3_NEOFI DNA-directed RNA polymerase III subunit rpc3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rpc82 PE=3 SV=1 3 204 6.0E-22
sp|A6R9K6|RPC3_AJECN DNA-directed RNA polymerase III subunit rpc3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RPC82 PE=3 SV=1 3 124 5.0E-21
sp|Q2U9X7|RPC3_ASPOR DNA-directed RNA polymerase III subunit rpc3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rpc82 PE=3 SV=1 2 124 5.0E-21
sp|Q5ATV8|RPC3_EMENI DNA-directed RNA polymerase III subunit rpc3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rpc82 PE=3 SV=2 2 230 4.0E-20
sp|Q0CE91|RPC3_ASPTN DNA-directed RNA polymerase III subunit rpc3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rpc82 PE=3 SV=1 3 124 1.0E-18
sp|Q9C106|RPC3_SCHPO DNA-directed RNA polymerase III subunit rpc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc82 PE=1 SV=1 3 139 2.0E-11
sp|A5DRM4|RPC3_LODEL DNA-directed RNA polymerase III subunit RPC3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RPC82 PE=3 SV=1 10 216 5.0E-11
sp|A5DQA6|RPC3_PICGU DNA-directed RNA polymerase III subunit RPC3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPC82 PE=3 SV=2 19 266 1.0E-09
sp|Q6C2E2|RPC3_YARLI DNA-directed RNA polymerase III subunit RPC3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPC82 PE=3 SV=1 9 127 8.0E-09
sp|A3LQX9|RPC3_PICST DNA-directed RNA polymerase III subunit RPC3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RPC82 PE=3 SV=1 19 196 9.0E-09
sp|Q5A246|RPC3_CANAL DNA-directed RNA polymerase III subunit RPC3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPC82 PE=3 SV=1 19 196 3.0E-08
sp|Q5XIL3|RPC3_RAT DNA-directed RNA polymerase III subunit RPC3 OS=Rattus norvegicus GN=Polr3c PE=2 SV=1 3 135 5.0E-08
sp|Q9D483|RPC3_MOUSE DNA-directed RNA polymerase III subunit RPC3 OS=Mus musculus GN=Polr3c PE=1 SV=1 3 135 7.0E-08
sp|Q2TBL4|RPC3_BOVIN DNA-directed RNA polymerase III subunit RPC3 OS=Bos taurus GN=POLR3C PE=2 SV=1 3 135 1.0E-06
sp|Q9BUI4|RPC3_HUMAN DNA-directed RNA polymerase III subunit RPC3 OS=Homo sapiens GN=POLR3C PE=1 SV=1 3 135 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0097747 RNA polymerase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4040
MLVTKHAAELCALLVNDLFGELPSRILVALFTKGRSNLTQLAQNTSLNPRFLRNGLGVLIQQNLLFYHTDPDTKV
TSYEANSDACYNLVRSGRILEVIESQYGTAERDLVQTLLLLGYARVADLTHAFGSRAPRTNGHSNGAFGSGSGKI
ESEDHLHLVLTRLIQDEIVETVRPDSFRNPADVYREIEAEITKTAPGERASKNKIEQHMQIVERFKAFRDQSSAL
KRQLDQTHGPGLKRRKLQNGSAHTVFKHSDDVSRLNPNVVVRPTLLEK*
Coding >Hirsu2|4040
ATGCTTGTCACCAAACATGCCGCTGAGCTTTGCGCTCTGCTAGTCAACGATCTCTTCGGCGAACTACCGTCGAGA
ATCCTGGTAGCCCTCTTCACCAAAGGACGATCCAACCTCACGCAGTTGGCGCAGAACACGTCGCTGAATCCTCGC
TTCCTTCGGAACGGCCTGGGCGTCTTAATACAGCAAAACCTGCTCTTCTATCACACGGATCCCGACACGAAAGTC
ACGAGTTACGAGGCCAACTCCGACGCCTGCTACAATCTCGTGCGATCCGGGAGAATACTAGAAGTCATCGAAAGC
CAGTACGGGACGGCGGAGAGAGACCTTGTCCAAACCCTCCTGCTCCTAGGGTACGCGCGAGTCGCAGACCTCACA
CATGCATTCGGCTCTCGAGCCCCGCGGACGAATGGGCACTCCAACGGAGCGTTTGGATCTGGCTCGGGCAAAATC
GAATCGGAGGATCATCTACACCTGGTCCTGACGCGTCTGATACAGGACGAGATTGTGGAAACAGTTCGACCTGAC
AGTTTCAGGAACCCGGCGGACGTGTATCGTGAAATTGAGGCCGAAATCACCAAGACTGCCCCTGGGGAGAGGGCT
TCGAAGAACAAGATCGAGCAGCACATGCAAATTGTCGAGCGTTTCAAAGCCTTCCGAGACCAGAGTAGCGCCCTG
AAGCGGCAGCTTGACCAAACCCATGGTCCCGGGTTGAAAAGGAGAAAGCTGCAAAATGGCAGCGCGCATACCGTA
TTCAAGCATTCGGACGACGTTTCGCGCCTCAACCCCAACGTCGTGGTCCGGCCGACACTTTTGGAGAAGTGA
Transcript >Hirsu2|4040
ATGCTTGTCACCAAACATGCCGCTGAGCTTTGCGCTCTGCTAGTCAACGATCTCTTCGGCGAACTACCGTCGAGA
ATCCTGGTAGCCCTCTTCACCAAAGGACGATCCAACCTCACGCAGTTGGCGCAGAACACGTCGCTGAATCCTCGC
TTCCTTCGGAACGGCCTGGGCGTCTTAATACAGCAAAACCTGCTCTTCTATCACACGGATCCCGACACGAAAGTC
ACGAGTTACGAGGCCAACTCCGACGCCTGCTACAATCTCGTGCGATCCGGGAGAATACTAGAAGTCATCGAAAGC
CAGTACGGGACGGCGGAGAGAGACCTTGTCCAAACCCTCCTGCTCCTAGGGTACGCGCGAGTCGCAGACCTCACA
CATGCATTCGGCTCTCGAGCCCCGCGGACGAATGGGCACTCCAACGGAGCGTTTGGATCTGGCTCGGGCAAAATC
GAATCGGAGGATCATCTACACCTGGTCCTGACGCGTCTGATACAGGACGAGATTGTGGAAACAGTTCGACCTGAC
AGTTTCAGGAACCCGGCGGACGTGTATCGTGAAATTGAGGCCGAAATCACCAAGACTGCCCCTGGGGAGAGGGCT
TCGAAGAACAAGATCGAGCAGCACATGCAAATTGTCGAGCGTTTCAAAGCCTTCCGAGACCAGAGTAGCGCCCTG
AAGCGGCAGCTTGACCAAACCCATGGTCCCGGGTTGAAAAGGAGAAAGCTGCAAAATGGCAGCGCGCATACCGTA
TTCAAGCATTCGGACGACGTTTCGCGCCTCAACCCCAACGTCGTGGTCCGGCCGACACTTTTGGAGAAGTGA
Gene >Hirsu2|4040
ATGCTTGTCGTCAGTGCCGCTCTCCGCCCAAACCCGTCCCGTCGCCTATCGCTTTTGCTGACGTGCCTCATGCAA
GACCAAACATGCCGCTGAGCTTTGCGCTCTGCTAGTCAACGATCTCTTCGGCGAACTACCGTCGGTGCGTTTCCC
GTGGCGGTTCGTCGCATCACAAGGCGTCACCGTTGCGCGCTGACTCAACCACACATGCGCAGAGAATCCTGGTAG
CCCTCTTCACCAAAGGACGATCCAACCTCACGCAGTTGGCGCAGAACACGTCGCTGAATCCTCGCTTCCTTCGGA
ACGGCCTGGGCGTCTTAATACAGCAAAACCTGCTCTTCTATCACACGGATCCCGACACGAAAGTCACGAGTTACG
AGGCCAACTCCGACGCCTGCTACAATCTCGTGCGATCCGGGAGAATACTAGAAGTCATCGAAAGCCAGTACGGGA
CGGCGGAGAGAGACCTTGTCCAAACCCTCCTGCTCCTAGGGTACGCGCGAGTCGCAGACCTCACACATGCATTCG
GCTCTCGAGCCCCGCGGACGAATGGGCACTCCAACGGAGCGTTTGGATCTGGCTCGGGCAAAATCGAATCGGAGG
ATCATCTACACCTGGTCCTGACGCGTCTGATACAGGACGAGATTGTGGAAACAGTTCGACCTGACAGTTTCAGGA
ACCCGGCGGACGTGTATCGTGAAATTGAGGCCGAAATCACCAAGACTGCCCCTGGGGAGAGGGCTTCGAAGAACA
AGATCGAGCAGCACATGCAAATTGTCGAGCGTTTCAAAGCCTTCCGAGACCAGAGTAGCGCCCTGAAGCGGCAGC
TTGACCAAACCCATGGTCCCGGGTTGAAAAGGAGAAAGCTGCAAAATGGCAGCGCGCATACCGTATTCAAGCATT
CGGACGACGTTTCGCGCCTCAACGTAAGTGGTCTTCTACAATACCGCATCAATTCTCCCCTGACATGGCATAGCC
CAACGTCGTGGTCCGGGTCAATCACGAGAAATGCCTGGTTCAACTGCGCAACCAGCGCCTGGCGGACTTCGCAGC
CGACACTTTTGGAGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail