Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4030
Gene name
LocationContig_21:17367..18550
Strand-
Gene length (bp)1183
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00682 HMGL-like HMGL-like 1.1E-42 37 339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I2A0|LIUE_PSEAE 3-hydroxy-3-isohexenylglutaryl-CoA/hydroxy-methylglutaryl-CoA lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=liuE PE=1 SV=1 36 351 2.0E-96
sp|P97519|HMGCL_RAT Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Rattus norvegicus GN=Hmgcl PE=2 SV=1 13 356 8.0E-91
sp|P13703|HMGCL_PSEMV Hydroxymethylglutaryl-CoA lyase OS=Pseudomonas mevalonii GN=mvaB PE=3 SV=1 38 363 1.0E-89
sp|P38060|HMGCL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus GN=Hmgcl PE=1 SV=2 21 356 1.0E-89
sp|Q8HXZ6|HMGCL_MACFA Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Macaca fascicularis GN=HMGCL PE=2 SV=1 21 356 1.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I2A0|LIUE_PSEAE 3-hydroxy-3-isohexenylglutaryl-CoA/hydroxy-methylglutaryl-CoA lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=liuE PE=1 SV=1 36 351 2.0E-96
sp|P97519|HMGCL_RAT Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Rattus norvegicus GN=Hmgcl PE=2 SV=1 13 356 8.0E-91
sp|P13703|HMGCL_PSEMV Hydroxymethylglutaryl-CoA lyase OS=Pseudomonas mevalonii GN=mvaB PE=3 SV=1 38 363 1.0E-89
sp|P38060|HMGCL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus GN=Hmgcl PE=1 SV=2 21 356 1.0E-89
sp|Q8HXZ6|HMGCL_MACFA Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Macaca fascicularis GN=HMGCL PE=2 SV=1 21 356 1.0E-89
sp|Q8JZS7|HMGC2_MOUSE 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Mus musculus GN=Hmgcll1 PE=2 SV=1 6 361 7.0E-89
sp|Q5R9E1|HMGCL_PONAB Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Pongo abelii GN=HMGCL PE=2 SV=1 1 356 8.0E-89
sp|Q29448|HMGCL_BOVIN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Bos taurus GN=HMGCL PE=2 SV=2 21 356 8.0E-89
sp|D4A5C3|HMGC2_RAT 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Rattus norvegicus GN=Hmgcll1 PE=1 SV=1 6 361 6.0E-88
sp|P35915|HMGCL_CHICK Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Gallus gallus GN=HMGCL PE=1 SV=1 33 356 2.0E-87
sp|P35914|HMGCL_HUMAN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Homo sapiens GN=HMGCL PE=1 SV=2 1 356 5.0E-87
sp|A8WG57|HMGC2_DANRE 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Danio rerio GN=hmgcll1 PE=2 SV=1 14 356 1.0E-83
sp|Q8TB92|HMGC2_HUMAN 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Homo sapiens GN=HMGCLL1 PE=1 SV=3 38 360 4.0E-83
sp|O81027|HMGCL_ARATH Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Arabidopsis thaliana GN=HMGCL PE=1 SV=2 38 357 3.0E-82
sp|O34873|HMGCL_BACSU Hydroxymethylglutaryl-CoA lyase YngG OS=Bacillus subtilis (strain 168) GN=yngG PE=1 SV=1 33 347 3.0E-71
sp|A9WGE2|CCL_CHLAA (R)-citramalyl-CoA lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=ccl PE=1 SV=1 38 356 1.0E-58
sp|C1AVG2|HOA4_RHOOB 4-hydroxy-2-oxovalerate aldolase 4 OS=Rhodococcus opacus (strain B4) GN=ROP_54050 PE=3 SV=1 57 347 9.0E-09
sp|B0TCR1|LEU1_HELMI 2-isopropylmalate synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuA PE=3 SV=1 35 355 1.0E-08
sp|Q8ZW35|LEU1_PYRAE Probable 2-isopropylmalate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuA PE=3 SV=1 147 346 1.0E-08
sp|C1B8I0|HOA2_RHOOB 4-hydroxy-2-oxovalerate aldolase 2 OS=Rhodococcus opacus (strain B4) GN=ROP_37360 PE=3 SV=1 57 347 3.0E-08
sp|D3DJ41|2OCL_HYDTT 2-oxoglutarate carboxylase large subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiA PE=1 SV=1 167 354 5.0E-08
sp|Q0S9W9|HOA2_RHOJR 4-hydroxy-2-oxovalerate aldolase 2 OS=Rhodococcus jostii (strain RHA1) GN=RHA1_ro03867 PE=3 SV=1 187 347 8.0E-08
sp|A8AB61|LEU1_IGNH4 Probable 2-isopropylmalate synthase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=leuA PE=3 SV=1 38 330 1.0E-07
sp|Q9RUA9|LEU1_DEIRA 2-isopropylmalate synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuA PE=3 SV=1 25 329 2.0E-07
sp|A3DF94|LEU1_CLOTH 2-isopropylmalate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuA PE=3 SV=1 37 358 2.0E-07
sp|B1I1Y1|LEU1_DESAP 2-isopropylmalate synthase OS=Desulforudis audaxviator (strain MP104C) GN=leuA PE=3 SV=1 35 355 3.0E-07
sp|O59390|HOSA_PYRHO Putative homocitrate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1727 PE=3 SV=1 157 299 9.0E-07
sp|Q764S0|HOA_BACPJ 4-hydroxy-2-oxovalerate aldolase OS=Bacillus sp. (strain JF8) GN=nahM PE=3 SV=2 190 342 3.0E-06
sp|Q9JZG1|LEU1_NEIMB 2-isopropylmalate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuA PE=1 SV=1 34 330 4.0E-06
sp|Q8TW28|AKSA_METKA Putative homocitrate synthase AksA OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aksA PE=3 SV=1 157 362 4.0E-06
sp|Q2LWJ3|LEU1_SYNAS 2-isopropylmalate synthase OS=Syntrophus aciditrophicus (strain SB) GN=leuA PE=3 SV=1 37 362 5.0E-06
sp|C0ZDU6|HOA_BREBN 4-hydroxy-2-oxovalerate aldolase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=BBR47_29780 PE=3 SV=1 216 337 8.0E-06
sp|A8H9A1|LEU1_SHEPA 2-isopropylmalate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=leuA PE=3 SV=1 35 362 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4030
MSALRPAVCRACRRSQAQLRRGLATASRQQPPPQSNRVKLVEVGPRDGLQNEKRTIPVATKIELIERLARTGVST
IEAGSFVSPKWVPQMANSSDIMEHLLERKIQSPAPMTYSFLVPNVKGLENAAGILKQHLGAFSTQLDPGADEAAA
ARPVVEVAVFAAATESFSQRNLNCDVQTSLERFKAVIQDAKALGLRVRAYVSVVLGCPFEGFDVDPHRVAEVATD
LLESGADEISLGDTTGMGTAPRTAALLKCMTAAGIRNEDVAMHFHDTYGQALVNTAVALEHGIRTFDSSVGGLGG
CPYSPGATGNVATENMVYFMETLGMDTGIDLDAVADIGAWITAELGKANDSSVGKAVLGARARGAAGTAEA*
Coding >Hirsu2|4030
ATGTCTGCACTTCGACCAGCCGTCTGCAGGGCTTGCAGGCGGTCCCAGGCCCAATTACGGAGGGGCCTCGCCACG
GCCAGCCGGCAGCAGCCTCCGCCGCAGTCGAACCGGGTCAAGCTTGTCGAGGTCGGACCCCGCGACGGGCTGCAG
AACGAGAAGAGGACGATTCCGGTGGCGACCAAGATCGAGCTGATTGAGCGGCTGGCGAGGACGGGCGTGTCGACC
ATCGAGGCCGGGTCTTTTGTGTCTCCGAAATGGGTTCCTCAGATGGCCAACTCTAGCGACATCATGGAGCACCTG
CTCGAGCGCAAGATCCAGTCGCCCGCGCCGATGACGTACTCCTTCCTCGTGCCCAACGTCAAGGGGCTGGAGAAC
GCGGCGGGCATCCTCAAACAGCACCTCGGGGCCTTCTCGACGCAGCTGGACCCGGGCGCGGACGAGGCGGCGGCG
GCGCGGCCCGTGGTGGAGGTGGCCGTGTTCGCGGCGGCGACGGAGAGCTTCTCGCAGCGGAACCTCAACTGCGAC
GTGCAGACGTCGCTGGAGCGGTTCAAGGCGGTGATCCAGGACGCCAAGGCGCTGGGGCTGCGCGTGCGCGCCTAC
GTCTCCGTCGTGCTGGGCTGCCCGTTCGAGGGCTTCGACGTCGACCCGCACCGGGTGGCCGAGGTGGCGACGGAC
CTGCTCGAGTCGGGCGCCGACGAGATCTCGCTCGGCGACACGACGGGCATGGGCACGGCGCCGCGGACGGCGGCC
CTGCTCAAGTGCATGACGGCGGCGGGGATCCGCAACGAGGACGTGGCCATGCACTTCCACGACACGTACGGGCAG
GCCCTCGTCAACACGGCCGTCGCGCTCGAGCACGGCATCCGCACCTTCGACAGCAGCGTCGGCGGCCTGGGCGGC
TGCCCGTACAGCCCCGGCGCCACCGGCAACGTCGCGACCGAGAACATGGTCTACTTCATGGAGACGCTCGGCATG
GACACGGGCATCGACCTCGACGCCGTGGCGGACATTGGCGCCTGGATCACGGCCGAGCTGGGCAAGGCCAACGAC
AGCTCCGTCGGCAAGGCCGTGCTCGGCGCGAGGGCGAGGGGGGCGGCGGGGACGGCCGAGGCGTGA
Transcript >Hirsu2|4030
ATGTCTGCACTTCGACCAGCCGTCTGCAGGGCTTGCAGGCGGTCCCAGGCCCAATTACGGAGGGGCCTCGCCACG
GCCAGCCGGCAGCAGCCTCCGCCGCAGTCGAACCGGGTCAAGCTTGTCGAGGTCGGACCCCGCGACGGGCTGCAG
AACGAGAAGAGGACGATTCCGGTGGCGACCAAGATCGAGCTGATTGAGCGGCTGGCGAGGACGGGCGTGTCGACC
ATCGAGGCCGGGTCTTTTGTGTCTCCGAAATGGGTTCCTCAGATGGCCAACTCTAGCGACATCATGGAGCACCTG
CTCGAGCGCAAGATCCAGTCGCCCGCGCCGATGACGTACTCCTTCCTCGTGCCCAACGTCAAGGGGCTGGAGAAC
GCGGCGGGCATCCTCAAACAGCACCTCGGGGCCTTCTCGACGCAGCTGGACCCGGGCGCGGACGAGGCGGCGGCG
GCGCGGCCCGTGGTGGAGGTGGCCGTGTTCGCGGCGGCGACGGAGAGCTTCTCGCAGCGGAACCTCAACTGCGAC
GTGCAGACGTCGCTGGAGCGGTTCAAGGCGGTGATCCAGGACGCCAAGGCGCTGGGGCTGCGCGTGCGCGCCTAC
GTCTCCGTCGTGCTGGGCTGCCCGTTCGAGGGCTTCGACGTCGACCCGCACCGGGTGGCCGAGGTGGCGACGGAC
CTGCTCGAGTCGGGCGCCGACGAGATCTCGCTCGGCGACACGACGGGCATGGGCACGGCGCCGCGGACGGCGGCC
CTGCTCAAGTGCATGACGGCGGCGGGGATCCGCAACGAGGACGTGGCCATGCACTTCCACGACACGTACGGGCAG
GCCCTCGTCAACACGGCCGTCGCGCTCGAGCACGGCATCCGCACCTTCGACAGCAGCGTCGGCGGCCTGGGCGGC
TGCCCGTACAGCCCCGGCGCCACCGGCAACGTCGCGACCGAGAACATGGTCTACTTCATGGAGACGCTCGGCATG
GACACGGGCATCGACCTCGACGCCGTGGCGGACATTGGCGCCTGGATCACGGCCGAGCTGGGCAAGGCCAACGAC
AGCTCCGTCGGCAAGGCCGTGCTCGGCGCGAGGGCGAGGGGGGCGGCGGGGACGGCCGAGGCGTGA
Gene >Hirsu2|4030
ATGTCTGCACTTCGACCAGCCGTCTGCAGGGCTTGCAGGCGGTCCCAGGCCCAATTACGGAGGGGCCTCGCCACG
GCCAGCCGGCAGCAGCCTCCGCCGCAGTCGAACCGGGTCAAGCTTGTCGAGGTCGGACCCCGCGACGGGCTGCAG
AACGAGAAGAGGACGATTCCGGTGGCGACCAAGATCGAGCTGATTGAGCGGCTGGCGAGGACGGGCGTGTCGACC
ATCGAGGCCGGGTCTTTTGTGTCTCCGAAATGGGTTCCTCAGGTGAGCTTGGCGCTTGCGGGATGCGACGACGGG
AGGCTGATTCCAGGCAATCTGTCGATGTGTATAGATGGCCAACTCTAGCGACATCATGGAGCACCTGCTCGAGCG
CAAGATCCAGTCGCCCGCGCCGATGACGTACTCCTTCCTCGTGCCCAACGTCAAGGGGCTGGAGAACGCGGCGGG
CATCCTCAAACAGCACCTCGGGGCCTTCTCGACGCAGCTGGACCCGGGCGCGGACGAGGCGGCGGCGGCGCGGCC
CGTGGTGGAGGTGGCCGTGTTCGCGGCGGCGACGGAGAGCTTCTCGCAGCGGAACCTCAACTGCGACGTGCAGAC
GTCGCTGGAGCGGTTCAAGGCGGTGATCCAGGACGCCAAGGCGCTGGGGCTGCGCGTGCGCGCCTACGTCTCCGT
CGTGCTGGGCTGCCCGTTCGAGGGCTTCGACGTCGACCCGCACCGGGTGGCCGAGGTGGCGACGGACCTGCTCGA
GTCGGGCGCCGACGAGATCTCGCTCGGCGACACGACGGGCATGGGCACGGCGCCGCGGACGGCGGCCCTGCTCAA
GTGCATGACGGCGGCGGGGATCCGCAACGAGGACGTGGCCATGCACTTCCACGACACGTACGGGCAGGCCCTCGT
CAACACGGCCGTCGCGCTCGAGCACGGCATCCGCACCTTCGACAGCAGCGTCGGCGGCCTGGGCGGCTGCCCGTA
CAGCCCCGGCGCCACCGGCAACGTCGCGACCGAGAACATGGTCTACTTCATGGAGACGCTCGGCATGGACACGGG
CATCGACCTCGACGCCGTGGCGGACATTGGCGCCTGGATCACGGCCGAGCTGGGCAAGGCCAACGACAGCTCCGT
CGGCAAGGCCGTGCTCGGCGCGAGGGCGAGGGGGGCGGCGGGGACGGCCGAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail