Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4021
Gene name
LocationContig_2099:2606..3254
Strand-
Gene length (bp)648
Transcript length (bp)567
Coding sequence length (bp)567
Protein length (aa) 189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14618 DUF4452 Domain of unknown function (DUF4452) 2.2E-76 22 184

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10296|YD42_SCHPO Uncharacterized protein C22H10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H10.02 PE=1 SV=2 59 164 6.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4021
MASYYHYNAQAAHAAPISHNNHHGGGRNRRAPRLSVSHNPQRQFRGARSLKDLNESAALSAFRVKFEAGRSFELE
DDLEFCPNLLTDTDLVSMSSASERSSLASNSPESSPTQQPQTVAPAFSLNSSSPAFIPPSFQGQQSSLKLDQPSA
TRGRNAIPIVNPATGISMSSPPPSVSPAAMQQSLARRW*
Coding >Hirsu2|4021
ATGGCTTCATACTACCATTACAATGCCCAGGCGGCACACGCGGCGCCCATTTCGCATAATAACCACCACGGCGGC
GGGCGGAACCGCCGGGCGCCCCGCCTGTCCGTCTCACACAATCCGCAGAGGCAGTTCCGTGGCGCTCGCAGCCTC
AAGGACCTCAACGAGTCGGCGGCCCTGTCCGCCTTCCGCGTCAAGTTTGAAGCAGGCCGCTCCTTTGAGCTTGAG
GACGACCTCGAGTTCTGCCCCAACCTGTTGACAGACACCGACCTGGTGTCCATGTCCAGTGCCTCGGAACGTTCG
TCACTGGCGAGCAACTCGCCCGAGTCGTCCCCTACGCAACAACCGCAAACCGTCGCGCCCGCCTTCTCCCTCAAC
TCGTCCTCTCCCGCCTTCATCCCCCCCAGCTTCCAGGGCCAACAATCCAGCCTCAAACTTGACCAACCCTCGGCT
ACCCGTGGTCGAAACGCCATTCCCATCGTCAACCCGGCCACCGGCATCTCCATGTCCAGCCCACCGCCCTCTGTG
TCGCCCGCCGCGATGCAGCAGTCGCTCGCCCGCCGATGGTAG
Transcript >Hirsu2|4021
ATGGCTTCATACTACCATTACAATGCCCAGGCGGCACACGCGGCGCCCATTTCGCATAATAACCACCACGGCGGC
GGGCGGAACCGCCGGGCGCCCCGCCTGTCCGTCTCACACAATCCGCAGAGGCAGTTCCGTGGCGCTCGCAGCCTC
AAGGACCTCAACGAGTCGGCGGCCCTGTCCGCCTTCCGCGTCAAGTTTGAAGCAGGCCGCTCCTTTGAGCTTGAG
GACGACCTCGAGTTCTGCCCCAACCTGTTGACAGACACCGACCTGGTGTCCATGTCCAGTGCCTCGGAACGTTCG
TCACTGGCGAGCAACTCGCCCGAGTCGTCCCCTACGCAACAACCGCAAACCGTCGCGCCCGCCTTCTCCCTCAAC
TCGTCCTCTCCCGCCTTCATCCCCCCCAGCTTCCAGGGCCAACAATCCAGCCTCAAACTTGACCAACCCTCGGCT
ACCCGTGGTCGAAACGCCATTCCCATCGTCAACCCGGCCACCGGCATCTCCATGTCCAGCCCACCGCCCTCTGTG
TCGCCCGCCGCGATGCAGCAGTCGCTCGCCCGCCGATGGTAG
Gene >Hirsu2|4021
ATGGCTTCATACTACCATTACAATGCCCAGGCGGCACACGCGGCGCCCATTTCGCATAATAACCACCACGGCGGC
GGGCGGAACCGCCGGGCGCCCCGCCTGTCCGTCTCACACAATCCGCAGAGGCAGTTCCGTGGCGCTCGCAGCCTC
AAGGACCTCAACGAGTCGGCGGCCCTGTCCGCCTTCCGCGTCAAGTTTGAAGCAGGCCGCTCCTTTGAGCTTGAG
GACGACCTCGAGTTCTGCCCCAACCTGTTGACAGACACCGACGTGAGTAGCTGCGAACCGGCCGAGCCCTCCCCT
CTCGTCGTCGGCAACCCTTAGCATCTGACTTTTCAACCTCGGCAATAGCTGGTGTCCATGTCCAGTGCCTCGGAA
CGTTCGTCACTGGCGAGCAACTCGCCCGAGTCGTCCCCTACGCAACAACCGCAAACCGTCGCGCCCGCCTTCTCC
CTCAACTCGTCCTCTCCCGCCTTCATCCCCCCCAGCTTCCAGGGCCAACAATCCAGCCTCAAACTTGACCAACCC
TCGGCTACCCGTGGTCGAAACGCCATTCCCATCGTCAACCCGGCCACCGGCATCTCCATGTCCAGCCCACCGCCC
TCTGTGTCGCCCGCCGCGATGCAGCAGTCGCTCGCCCGCCGATGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail