Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4011
Gene name
LocationContig_2092:80..947
Strand-
Gene length (bp)867
Transcript length (bp)750
Coding sequence length (bp)750
Protein length (aa) 250

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 3.8E-15 54 217
PF08241 Methyltransf_11 Methyltransferase domain 1.7E-13 61 171
PF13649 Methyltransf_25 Methyltransferase domain 1.6E-12 61 167
PF08242 Methyltransf_12 Methyltransferase domain 5.8E-11 61 169
PF13847 Methyltransf_31 Methyltransferase domain 4.6E-08 58 175
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.1E-05 54 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94628|YGE9_SCHPO Uncharacterized methyltransferase C1347.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1347.09 PE=3 SV=1 55 223 7.0E-15
sp|Q0HZP7|UBIE_SHESR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 59 175 3.0E-07
sp|Q0HEA1|UBIE_SHESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 59 175 3.0E-07
sp|A0L1M4|UBIE_SHESA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 59 175 3.0E-07
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 59 173 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94628|YGE9_SCHPO Uncharacterized methyltransferase C1347.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1347.09 PE=3 SV=1 55 223 7.0E-15
sp|Q0HZP7|UBIE_SHESR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 59 175 3.0E-07
sp|Q0HEA1|UBIE_SHESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 59 175 3.0E-07
sp|A0L1M4|UBIE_SHESA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 59 175 3.0E-07
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 59 173 4.0E-07
sp|Q8E9R7|UBIE_SHEON Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 59 175 5.0E-07
sp|Q5YPB0|MENG_NOCFA Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 59 189 5.0E-07
sp|A1SAJ8|UBIE_SHEAM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 59 175 5.0E-07
sp|Q73SL8|MENG_MYCPA Demethylmenaquinone methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=menG PE=3 SV=2 59 229 6.0E-07
sp|Q088H8|UBIE_SHEFN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 59 176 9.0E-07
sp|Q5QZ53|UBIG_IDILO Ubiquinone biosynthesis O-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiG PE=3 SV=1 53 170 1.0E-06
sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 55 175 2.0E-06
sp|Q02EV4|UBIE_PSEAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 55 175 2.0E-06
sp|B7V3F6|UBIE_PSEA8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 55 175 2.0E-06
sp|A6VDI6|UBIE_PSEA7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 55 174 2.0E-06
sp|Q8PK00|UBIG_XANAC Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 58 171 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4011
MDHTFAHKNEEFWNSAAESVFKNEWIHHLQAQISSFLTGRADWLAVQPPKDHDGKTTARLLDYACGNGIVTRSLH
PVFSQCIGVDLAEGMLAQYRATAAEIGLSEAQARAVQGNLLAPNIEATATSPPLSEEQLSNFDMVAICMALHHVD
DIELATRRLAQRLRPGGVLLIIDWATRDGSASETTPLQYQPHPAAHTISHDSFTQDQILGLFQQAGCGDSRFVLA
DQLSDVPGALGGKMQLFFARASKL*
Coding >Hirsu2|4011
ATGGACCATACATTCGCACACAAGAACGAGGAGTTTTGGAACTCCGCCGCCGAGTCTGTCTTCAAGAACGAGTGG
ATCCATCATCTCCAGGCGCAGATCTCCAGCTTTTTGACAGGCCGTGCCGACTGGCTGGCCGTGCAGCCGCCCAAA
GACCACGACGGAAAAACGACGGCAAGGCTATTGGATTACGCTTGCGGCAATGGCATCGTGACGCGTTCACTTCAC
CCTGTCTTTAGTCAGTGCATCGGCGTCGACCTTGCCGAGGGCATGCTAGCCCAGTATCGGGCCACGGCCGCCGAG
ATCGGCCTGTCCGAGGCGCAGGCCAGGGCAGTCCAAGGCAACCTCCTAGCGCCCAATATTGAAGCTACAGCTACT
AGTCCTCCACTGAGCGAGGAGCAGCTCAGCAACTTCGATATGGTCGCAATCTGCATGGCACTTCATCACGTCGAC
GACATTGAACTGGCCACGAGGCGGCTTGCACAGAGATTGCGGCCTGGGGGCGTGCTCCTCATCATCGATTGGGCC
ACAAGGGACGGGTCGGCGAGCGAGACAACCCCTCTTCAATACCAACCGCATCCTGCGGCGCACACAATTTCACAT
GATAGCTTCACCCAAGACCAGATATTGGGACTTTTCCAACAGGCCGGCTGTGGTGACTCGAGGTTTGTCTTGGCT
GATCAACTTTCCGACGTGCCCGGTGCCCTTGGTGGCAAAATGCAGTTGTTTTTCGCCCGTGCATCCAAGCTTTAG
Transcript >Hirsu2|4011
ATGGACCATACATTCGCACACAAGAACGAGGAGTTTTGGAACTCCGCCGCCGAGTCTGTCTTCAAGAACGAGTGG
ATCCATCATCTCCAGGCGCAGATCTCCAGCTTTTTGACAGGCCGTGCCGACTGGCTGGCCGTGCAGCCGCCCAAA
GACCACGACGGAAAAACGACGGCAAGGCTATTGGATTACGCTTGCGGCAATGGCATCGTGACGCGTTCACTTCAC
CCTGTCTTTAGTCAGTGCATCGGCGTCGACCTTGCCGAGGGCATGCTAGCCCAGTATCGGGCCACGGCCGCCGAG
ATCGGCCTGTCCGAGGCGCAGGCCAGGGCAGTCCAAGGCAACCTCCTAGCGCCCAATATTGAAGCTACAGCTACT
AGTCCTCCACTGAGCGAGGAGCAGCTCAGCAACTTCGATATGGTCGCAATCTGCATGGCACTTCATCACGTCGAC
GACATTGAACTGGCCACGAGGCGGCTTGCACAGAGATTGCGGCCTGGGGGCGTGCTCCTCATCATCGATTGGGCC
ACAAGGGACGGGTCGGCGAGCGAGACAACCCCTCTTCAATACCAACCGCATCCTGCGGCGCACACAATTTCACAT
GATAGCTTCACCCAAGACCAGATATTGGGACTTTTCCAACAGGCCGGCTGTGGTGACTCGAGGTTTGTCTTGGCT
GATCAACTTTCCGACGTGCCCGGTGCCCTTGGTGGCAAAATGCAGTTGTTTTTCGCCCGTGCATCCAAGCTTTAG
Gene >Hirsu2|4011
ATGGACCATACATTCGCACACAAGAACGAGGAGTTTTGGAAGTGAGTAACAATGCACGCTCTCCTTACCGCATCT
CCCGTCTCACAAGTCCCCGCACAGCTCCGCCGCCGAGTCTGTCTTCAAGAACGAGTGGATCCATCATCTCCAGGC
GCAGATCTCCAGCTTTTTGACAGGCCGTGCCGACTGGCTGGCCGTGCAGCCGCCCAAAGACCACGACGGAAAAAC
GACGGCAAGGCTATTGGATTACGCTTGCGGCAATGGCATCGTGACGCGTGTACGCAAAAGCCAACCACTAAAACT
CCTACACGGTTCCCGCTGACGGAGCTTATGTAGTCACTTCACCCTGTCTTTAGTCAGTGCATCGGCGTCGACCTT
GCCGAGGGCATGCTAGCCCAGTATCGGGCCACGGCCGCCGAGATCGGCCTGTCCGAGGCGCAGGCCAGGGCAGTC
CAAGGCAACCTCCTAGCGCCCAATATTGAAGCTACAGCTACTAGTCCTCCACTGAGCGAGGAGCAGCTCAGCAAC
TTCGATATGGTCGCAATCTGCATGGCACTTCATCACGTCGACGACATTGAACTGGCCACGAGGCGGCTTGCACAG
AGATTGCGGCCTGGGGGCGTGCTCCTCATCATCGATTGGGCCACAAGGGACGGGTCGGCGAGCGAGACAACCCCT
CTTCAATACCAACCGCATCCTGCGGCGCACACAATTTCACATGATAGCTTCACCCAAGACCAGATATTGGGACTT
TTCCAACAGGCCGGCTGTGGTGACTCGAGGTTTGTCTTGGCTGATCAACTTTCCGACGTGCCCGGTGCCCTTGGT
GGCAAAATGCAGTTGTTTTTCGCCCGTGCATCCAAGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail