Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4010
Gene name
LocationContig_2091:147..3562
Strand-
Gene length (bp)3415
Transcript length (bp)3249
Coding sequence length (bp)3249
Protein length (aa) 1083

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 8.2E-214 13 645
PF08264 Anticodon_1 Anticodon-binding domain of tRNA 4.1E-22 702 856
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 7.1E-06 42 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13651|SYIC_SCHPO Isoleucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irs1 PE=3 SV=1 1 1082 0.0E+00
sp|P09436|SYIC_YEAST Isoleucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILS1 PE=1 SV=1 4 1082 0.0E+00
sp|P41252|SYIC_HUMAN Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=IARS PE=1 SV=2 2 1081 0.0E+00
sp|Q8BU30|SYIC_MOUSE Isoleucine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Iars PE=1 SV=2 2 1068 0.0E+00
sp|Q54YD4|SYIC_DICDI Probable isoleucine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=ileS PE=3 SV=1 3 1020 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13651|SYIC_SCHPO Isoleucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irs1 PE=3 SV=1 1 1082 0.0E+00
sp|P09436|SYIC_YEAST Isoleucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILS1 PE=1 SV=1 4 1082 0.0E+00
sp|P41252|SYIC_HUMAN Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=IARS PE=1 SV=2 2 1081 0.0E+00
sp|Q8BU30|SYIC_MOUSE Isoleucine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Iars PE=1 SV=2 2 1068 0.0E+00
sp|Q54YD4|SYIC_DICDI Probable isoleucine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=ileS PE=3 SV=1 3 1020 0.0E+00
sp|Q21926|SYIC_CAEEL Isoleucine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=irs-1 PE=3 SV=1 2 1028 0.0E+00
sp|F4JLM5|SYIC_ARATH Isoleucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At4g10320 PE=2 SV=1 4 1056 0.0E+00
sp|P36422|SYI_TETTH Isoleucine--tRNA ligase OS=Tetrahymena thermophila GN=ILSA PE=3 SV=1 4 1050 0.0E+00
sp|Q6MKX0|SYI_BDEBA Isoleucine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ileS PE=3 SV=1 3 1019 0.0E+00
sp|Q65ZU1|SYI_BORBP Isoleucine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=ileS PE=3 SV=1 3 1018 0.0E+00
sp|B7J0S6|SYI_BORBZ Isoleucine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=ileS PE=3 SV=1 3 1018 0.0E+00
sp|O51773|SYI_BORBU Isoleucine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=ileS PE=3 SV=1 3 1018 0.0E+00
sp|Q0SM18|SYI_BORAP Isoleucine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=ileS PE=3 SV=1 3 1018 0.0E+00
sp|B0B9C6|SYI_CHLT2 Isoleucine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ileS PE=3 SV=1 3 1018 0.0E+00
sp|B0BB05|SYI_CHLTB Isoleucine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=ileS PE=3 SV=1 3 1018 0.0E+00
sp|O84022|SYI_CHLTR Isoleucine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=ileS PE=3 SV=1 3 1018 0.0E+00
sp|Q6MDY1|SYI_PARUW Isoleucine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=ileS PE=3 SV=1 4 1018 0.0E+00
sp|Q9PL20|SYI_CHLMU Isoleucine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=ileS PE=3 SV=1 3 1059 0.0E+00
sp|B5RN32|SYI_BORDL Isoleucine--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=ileS PE=3 SV=1 3 1016 0.0E+00
sp|B5RQH0|SYI_BORRA Isoleucine--tRNA ligase OS=Borrelia recurrentis (strain A1) GN=ileS PE=3 SV=1 3 1016 0.0E+00
sp|Q3KN03|SYI_CHLTA Isoleucine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=ileS PE=3 SV=1 3 1018 0.0E+00
sp|B2S1H8|SYI_BORHD Isoleucine--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=ileS PE=3 SV=1 3 1016 0.0E+00
sp|A1R0Q9|SYI_BORT9 Isoleucine--tRNA ligase OS=Borrelia turicatae (strain 91E135) GN=ileS PE=3 SV=1 3 1016 0.0E+00
sp|Q9Z972|SYI_CHLPN Isoleucine--tRNA ligase OS=Chlamydia pneumoniae GN=ileS PE=3 SV=1 4 1018 0.0E+00
sp|Q73JB2|SYI_TREDE Isoleucine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=ileS PE=3 SV=1 3 1055 0.0E+00
sp|Q5L5L0|SYI_CHLAB Isoleucine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=ileS PE=3 SV=1 9 1016 0.0E+00
sp|Q8SQV6|SYIC_ENCCU Probable isoleucine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1100 PE=3 SV=1 2 1033 0.0E+00
sp|Q822L8|SYI_CHLCV Isoleucine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=ileS PE=3 SV=1 9 1059 0.0E+00
sp|C4V8Q1|SYIC_NOSCE Probable isoleucine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100885 PE=3 SV=1 9 1019 0.0E+00
sp|B2S348|SYI_TREPS Isoleucine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=ileS PE=3 SV=1 3 1016 0.0E+00
sp|O83466|SYI_TREPA Isoleucine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=ileS PE=3 SV=1 3 1016 0.0E+00
sp|B7XK16|SYIC_ENTBH Probable isoleucine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22873 PE=3 SV=1 3 932 0.0E+00
sp|Q8L1B1|SYI2_PSEFL Isoleucine--tRNA ligase 2 OS=Pseudomonas fluorescens GN=ileS2 PE=1 SV=3 3 1038 0.0E+00
sp|Q6NGD7|SYI_CORDI Isoleucine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=ileS PE=3 SV=1 5 1022 0.0E+00
sp|Q8NNP0|SYI_CORGL Isoleucine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ileS PE=3 SV=1 2 1027 0.0E+00
sp|A8EY49|SYI_RICCK Isoleucine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=ileS PE=3 SV=1 2 1025 0.0E+00
sp|Q7VEZ0|SYI_MYCBO Isoleucine--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ileS PE=3 SV=1 4 1018 0.0E+00
sp|P9WFV3|SYI_MYCTU Isoleucine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ileS PE=1 SV=1 4 1018 0.0E+00
sp|P9WFV2|SYI_MYCTO Isoleucine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ileS PE=3 SV=1 4 1018 0.0E+00
sp|Q4UMD8|SYI_RICFE Isoleucine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ileS PE=3 SV=1 2 1039 0.0E+00
sp|C4K2T0|SYI_RICPU Isoleucine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=ileS PE=3 SV=1 2 1021 0.0E+00
sp|C3PP60|SYI_RICAE Isoleucine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=ileS PE=3 SV=1 2 1021 0.0E+00
sp|Q68WC2|SYI_RICTY Isoleucine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ileS PE=3 SV=1 2 1039 0.0E+00
sp|Q9X7E5|SYI_MYCLE Isoleucine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=ileS PE=3 SV=1 2 1018 0.0E+00
sp|Q899C3|SYI_CLOTE Isoleucine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=ileS PE=3 SV=2 2 1048 0.0E+00
sp|Q8XHE4|SYI_CLOPE Isoleucine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=ileS PE=3 SV=1 9 1018 0.0E+00
sp|Q92H19|SYI_RICCN Isoleucine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ileS PE=3 SV=2 2 1021 0.0E+00
sp|A5N3P1|SYI_CLOK5 Isoleucine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=ileS PE=3 SV=1 4 1018 0.0E+00
sp|Q740U6|SYI_MYCPA Isoleucine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ileS PE=3 SV=1 4 1028 0.0E+00
sp|A0Q3B0|SYI_CLONN Isoleucine--tRNA ligase OS=Clostridium novyi (strain NT) GN=ileS PE=3 SV=1 2 1018 0.0E+00
sp|Q8FNV0|SYI_COREF Isoleucine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ileS PE=3 SV=2 2 1025 0.0E+00
sp|Q5YYW9|SYI_NOCFA Isoleucine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=ileS PE=3 SV=1 5 1028 0.0E+00
sp|Q4JW85|SYI_CORJK Isoleucine--tRNA ligase OS=Corynebacterium jeikeium (strain K411) GN=ileS PE=3 SV=1 2 1026 0.0E+00
sp|A8GW18|SYI_RICB8 Isoleucine--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=ileS PE=3 SV=1 2 1019 0.0E+00
sp|Q9ZCU4|SYI_RICPR Isoleucine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=ileS PE=3 SV=1 2 1046 0.0E+00
sp|Q5FH91|SYI_EHRRG Isoleucine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=ileS PE=3 SV=2 4 1055 0.0E+00
sp|Q1RIY1|SYI_RICBR Isoleucine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=ileS PE=3 SV=1 2 1019 0.0E+00
sp|Q5HB43|SYI_EHRRW Isoleucine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=ileS PE=3 SV=2 4 1055 0.0E+00
sp|Q73HW7|SYI_WOLPM Isoleucine--tRNA ligase OS=Wolbachia pipientis wMel GN=ileS PE=3 SV=1 2 1018 0.0E+00
sp|Q97ES0|SYI_CLOAB Isoleucine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ileS PE=3 SV=1 2 1018 0.0E+00
sp|Q5GSS3|SYI_WOLTR Isoleucine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=ileS PE=3 SV=1 2 1018 0.0E+00
sp|Q47QV9|SYI_THEFY Isoleucine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=ileS PE=3 SV=1 3 1018 0.0E+00
sp|A8GPA1|SYI_RICAH Isoleucine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=ileS PE=3 SV=1 2 1021 0.0E+00
sp|Q5PAL9|SYI_ANAMM Isoleucine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=ileS PE=3 SV=1 5 1014 0.0E+00
sp|Q3YRX3|SYI_EHRCJ Isoleucine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=ileS PE=3 SV=1 4 1055 0.0E+00
sp|Q72JR6|SYI_THET2 Isoleucine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ileS PE=3 SV=2 4 1020 0.0E+00
sp|Q27707|SYI_ANTLO Isoleucine--tRNA ligase (Fragment) OS=Antonospora locustae PE=3 SV=1 79 747 0.0E+00
sp|Q83G52|SYI_TROWT Isoleucine--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=ileS PE=3 SV=2 4 1067 0.0E+00
sp|Q83I16|SYI_TROW8 Isoleucine--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=ileS PE=3 SV=1 4 1067 0.0E+00
sp|P56690|SYI_THET8 Isoleucine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ileS PE=1 SV=2 4 1020 0.0E+00
sp|Q82AC9|SYI_STRAW Isoleucine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ileS PE=3 SV=1 3 1033 0.0E+00
sp|Q8KFL5|SYI_CHLTE Isoleucine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=ileS PE=3 SV=1 2 1018 0.0E+00
sp|Q8ET99|SYI2_OCEIH Isoleucine--tRNA ligase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ileS2 PE=3 SV=1 3 1075 0.0E+00
sp|Q9S2X5|SYI_STRCO Isoleucine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ileS PE=3 SV=1 3 1030 0.0E+00
sp|Q81E30|SYI2_BACCR Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ileS2 PE=3 SV=2 14 1046 0.0E+00
sp|Q6HJF2|SYI2_BACHK Isoleucine--tRNA ligase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ileS2 PE=3 SV=1 14 1046 0.0E+00
sp|Q6AFZ0|SYI_LEIXX Isoleucine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=ileS PE=3 SV=1 5 1018 0.0E+00
sp|Q63BZ8|SYI2_BACCZ Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ZK / E33L) GN=ileS2 PE=3 SV=1 14 1046 0.0E+00
sp|A0RDG3|SYI_BACAH Isoleucine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=ileS PE=3 SV=1 14 1046 0.0E+00
sp|P41368|SYI2_STAAU Isoleucine--tRNA ligase OS=Staphylococcus aureus GN=ileS PE=3 SV=1 16 1010 0.0E+00
sp|Q81R75|SYI2_BACAN Isoleucine--tRNA ligase 2 OS=Bacillus anthracis GN=ileS2 PE=3 SV=1 14 1046 0.0E+00
sp|Q739A1|SYI2_BACC1 Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ileS2 PE=3 SV=1 14 1046 0.0E+00
sp|Q11NV4|SYI_CYTH3 Isoleucine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ileS PE=3 SV=1 16 1072 0.0E+00
sp|Q7MUD3|SYI_PORGI Isoleucine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ileS PE=3 SV=1 2 1025 0.0E+00
sp|Q8A9K9|SYI_BACTN Isoleucine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=ileS PE=3 SV=1 13 1018 0.0E+00
sp|Q5LCU8|SYI_BACFN Isoleucine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=ileS PE=3 SV=1 4 1018 0.0E+00
sp|Q64U07|SYI_BACFR Isoleucine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=ileS PE=3 SV=1 4 1018 0.0E+00
sp|Q7UNZ2|SYI_RHOBA Isoleucine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ileS PE=3 SV=1 2 1018 0.0E+00
sp|Q8G3I2|SYI_BIFLO Isoleucine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=ileS PE=3 SV=1 4 1026 0.0E+00
sp|Q3ZY20|SYI_DEHMC Isoleucine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=ileS PE=3 SV=1 4 888 0.0E+00
sp|Q3Z7P5|SYI_DEHM1 Isoleucine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=ileS PE=3 SV=1 4 889 0.0E+00
sp|Q6AB89|SYI_PROAC Isoleucine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=ileS PE=3 SV=1 3 1039 5.0E-178
sp|P26499|SYI_METTM Isoleucine--tRNA ligase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=ileS PE=1 SV=3 9 1027 5.0E-173
sp|Q9RUP8|SYI_DEIRA Isoleucine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ileS PE=3 SV=1 4 1018 1.0E-172
sp|O27428|SYI_METTH Isoleucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ileS PE=3 SV=3 9 1010 1.0E-171
sp|Q6L206|SYI_PICTO Isoleucine--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=ileS PE=3 SV=1 3 1017 6.0E-170
sp|Q9HJT4|SYI_THEAC Isoleucine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=ileS PE=3 SV=2 13 1025 6.0E-170
sp|Q97AG7|SYI_THEVO Isoleucine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=ileS PE=3 SV=1 13 1018 3.0E-169
sp|Q8TN62|SYI_METAC Isoleucine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ileS PE=3 SV=1 4 1018 1.0E-165
sp|Q465G4|SYI_METBF Isoleucine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=ileS PE=3 SV=1 4 1018 2.0E-163
sp|Q8PSV9|SYI_METMA Isoleucine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ileS PE=3 SV=1 9 1018 2.0E-162
sp|A0B7P3|SYI_METTP Isoleucine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=ileS PE=3 SV=1 9 1025 2.0E-160
sp|Q12ZD1|SYI_METBU Isoleucine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=ileS PE=3 SV=1 7 1017 1.0E-154
sp|Q2FPJ4|SYI_METHJ Isoleucine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ileS PE=3 SV=1 6 1022 1.0E-154
sp|O58792|SYI_PYRHO Isoleucine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ileS PE=3 SV=1 7 1016 8.0E-153
sp|Q9V072|SYI_PYRAB Isoleucine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ileS PE=3 SV=1 6 1016 2.0E-152
sp|P46214|SYI_PYRFU Isoleucine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ileS PE=3 SV=2 7 1016 2.0E-151
sp|Q5JJ31|SYI_THEKO Isoleucine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=ileS PE=3 SV=1 6 1016 4.0E-151
sp|A3CSI6|SYI_METMJ Isoleucine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ileS PE=3 SV=1 6 1014 2.0E-150
sp|A2SPV6|SYI_METLZ Isoleucine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=ileS PE=3 SV=1 14 1022 7.0E-150
sp|A7IAM2|SYI_METB6 Isoleucine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=ileS PE=3 SV=1 1 1022 2.0E-149
sp|Q58357|SYI_METJA Isoleucine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ileS PE=3 SV=1 3 1018 1.0E-148
sp|O29622|SYI_ARCFU Isoleucine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ileS PE=3 SV=1 6 1014 1.0E-148
sp|Q8TWY2|SYI_METKA Isoleucine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ileS PE=3 SV=1 15 1018 4.0E-148
sp|Q0W720|SYI_METAR Isoleucine--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=ileS PE=3 SV=1 9 1041 7.0E-145
sp|Q3ITY7|SYI_NATPD Isoleucine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ileS PE=3 SV=1 9 1019 2.0E-142
sp|Q18GW3|SYI_HALWD Isoleucine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ileS PE=3 SV=1 6 1025 3.0E-141
sp|Q6LX78|SYI_METMP Isoleucine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=ileS PE=3 SV=1 2 1040 6.0E-141
sp|Q9YF67|SYI_AERPE Isoleucine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=ileS PE=3 SV=1 16 1018 7.0E-141
sp|Q5UZ84|SYI_HALMA Isoleucine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ileS PE=3 SV=1 9 1047 2.0E-139
sp|A6UVK2|SYI_META3 Isoleucine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=ileS PE=3 SV=1 3 1018 6.0E-137
sp|Q9HN97|SYI_HALSA Isoleucine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=ileS PE=3 SV=1 9 1025 4.0E-136
sp|C3MVH6|SYI_SULIM Isoleucine--tRNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=ileS PE=3 SV=1 7 1018 7.0E-135
sp|C3N5S5|SYI_SULIA Isoleucine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=ileS PE=3 SV=1 7 1018 7.0E-135
sp|P46215|SYI_SULAC Isoleucine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ileS PE=3 SV=2 7 1024 5.0E-133
sp|Q9UXB1|SYI_SULSO Isoleucine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ileS PE=3 SV=1 58 1022 1.0E-128
sp|Q975H9|SYI_SULTO Isoleucine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ileS PE=3 SV=2 9 1014 2.0E-124
sp|Q8ZWU4|SYI_PYRAE Isoleucine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=ileS PE=3 SV=1 9 878 2.0E-121
sp|B7IGT1|SYI_THEAB Isoleucine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=ileS PE=3 SV=1 1 899 2.0E-107
sp|B9K8X3|SYI_THENN Isoleucine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=ileS PE=3 SV=1 1 826 1.0E-106
sp|A5IML2|SYI_THEP1 Isoleucine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=ileS PE=3 SV=1 1 826 1.0E-105
sp|P46213|SYI_THEMA Isoleucine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ileS PE=3 SV=2 1 823 2.0E-105
sp|Q9XDB4|SYI_FERPD Isoleucine--tRNA ligase OS=Fervidobacterium pennivorans (strain DSM 9078 / Ven5) GN=ileS PE=3 SV=3 1 901 2.0E-105
sp|Q0AYC7|SYI_SYNWW Isoleucine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=ileS PE=3 SV=1 1 842 6.0E-104
sp|C5CHA1|SYI_KOSOT Isoleucine--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ileS PE=3 SV=1 1 833 2.0E-103
sp|A6LK77|SYI_THEM4 Isoleucine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=ileS PE=3 SV=1 1 826 6.0E-102
sp|A8F465|SYI_PSELT Isoleucine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ileS PE=3 SV=1 1 826 6.0E-102
sp|B7IUQ5|SYI_BACC2 Isoleucine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=ileS PE=3 SV=1 1 826 1.0E-101
sp|B2A2I8|SYI_NATTJ Isoleucine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ileS PE=3 SV=1 1 889 3.0E-101
sp|A4J2F4|SYI_DESRM Isoleucine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=ileS PE=3 SV=1 1 836 5.0E-101
sp|B7H6N1|SYI_BACC4 Isoleucine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=ileS PE=3 SV=1 1 826 8.0E-101
sp|Q819R4|SYI1_BACCR Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ileS1 PE=3 SV=1 1 826 8.0E-101
sp|Q6HER9|SYI1_BACHK Isoleucine--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ileS1 PE=3 SV=1 1 826 1.0E-100
sp|C1EPQ9|SYI_BACC3 Isoleucine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=ileS PE=3 SV=1 1 826 1.0E-100
sp|Q5L0V9|SYI_GEOKA Isoleucine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=ileS PE=3 SV=1 1 815 2.0E-100
sp|B7JJY2|SYI_BACC0 Isoleucine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=ileS PE=3 SV=1 1 826 2.0E-100
sp|Q732H4|SYI1_BACC1 Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ileS1 PE=3 SV=1 1 819 2.0E-100
sp|B8CWL4|SYI_HALOH Isoleucine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ileS PE=3 SV=1 1 870 2.0E-100
sp|B9IVX2|SYI_BACCQ Isoleucine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=ileS PE=3 SV=1 1 819 3.0E-100
sp|B7HLM9|SYI_BACC7 Isoleucine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=ileS PE=3 SV=1 1 819 3.0E-100
sp|Q636D1|SYI1_BACCZ Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=ileS1 PE=3 SV=1 1 819 3.0E-100
sp|A7HMY6|SYI_FERNB Isoleucine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=ileS PE=3 SV=1 1 825 5.0E-100
sp|A9VTD5|SYI_BACWK Isoleucine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ileS PE=3 SV=1 1 819 2.0E-99
sp|A4IM25|SYI_GEOTN Isoleucine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ileS PE=3 SV=1 1 815 3.0E-99
sp|C3L730|SYI_BACAC Isoleucine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ileS PE=3 SV=1 1 826 5.0E-99
sp|C3P665|SYI_BACAA Isoleucine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=ileS PE=3 SV=1 1 826 5.0E-99
sp|Q81WE4|SYI1_BACAN Isoleucine--tRNA ligase 1 OS=Bacillus anthracis GN=ileS1 PE=3 SV=1 1 826 5.0E-99
sp|A7GRM0|SYI_BACCN Isoleucine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ileS PE=3 SV=1 1 837 2.0E-98
sp|B8FT35|SYI_DESHD Isoleucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=ileS PE=3 SV=1 1 934 3.0E-98
sp|Q24TH1|SYI_DESHY Isoleucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=ileS PE=3 SV=1 1 934 4.0E-98
sp|B2V9T1|SYI_SULSY Isoleucine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=ileS PE=3 SV=1 1 871 6.0E-98
sp|C5D8P2|SYI_GEOSW Isoleucine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=ileS PE=3 SV=1 1 817 9.0E-98
sp|Q3AEP2|SYI_CARHZ Isoleucine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=ileS PE=3 SV=1 1 884 2.0E-97
sp|Q2RK59|SYI_MOOTA Isoleucine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=ileS PE=3 SV=1 1 873 8.0E-97
sp|Q6AK45|SYI_DESPS Isoleucine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ileS PE=3 SV=1 1 887 1.0E-96
sp|B0K2W1|SYI_THEPX Isoleucine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=ileS PE=3 SV=1 1 820 4.0E-96
sp|B0K8R7|SYI_THEP3 Isoleucine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ileS PE=3 SV=1 1 820 4.0E-96
sp|A9BI29|SYI_PETMO Isoleucine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ileS PE=3 SV=1 1 871 5.0E-96
sp|Q8Y5N8|SYI_LISMO Isoleucine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ileS PE=3 SV=1 1 841 8.0E-96
sp|C0QP76|SYI_PERMH Isoleucine--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=ileS PE=3 SV=1 1 861 1.0E-95
sp|Q8RH47|SYI_FUSNN Isoleucine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=ileS PE=3 SV=1 1 793 2.0E-95
sp|A0AKC5|SYI_LISW6 Isoleucine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ileS PE=3 SV=1 1 841 3.0E-95
sp|Q5QZS6|SYI_IDILO Isoleucine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ileS PE=3 SV=1 1 796 4.0E-95
sp|Q929Z6|SYI_LISIN Isoleucine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ileS PE=3 SV=1 1 841 4.0E-95
sp|Q74JX6|SYI_LACJO Isoleucine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ileS PE=3 SV=2 1 904 6.0E-95
sp|Q71Y01|SYI_LISMF Isoleucine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ileS PE=3 SV=1 1 841 3.0E-94
sp|C1KWW3|SYI_LISMC Isoleucine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ileS PE=3 SV=1 1 841 3.0E-94
sp|B8DBR2|SYI_LISMH Isoleucine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=ileS PE=3 SV=1 1 841 4.0E-94
sp|A8YUP7|SYI_LACH4 Isoleucine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=ileS PE=3 SV=1 1 894 5.0E-94
sp|C0ZG86|SYI_BREBN Isoleucine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ileS PE=3 SV=1 1 829 7.0E-94
sp|A6W346|SYI_MARMS Isoleucine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=ileS PE=3 SV=1 1 793 2.0E-93
sp|B1I4A3|SYI_DESAP Isoleucine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=ileS PE=3 SV=1 1 869 3.0E-93
sp|Q45477|SYI_BACSU Isoleucine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=ileS PE=3 SV=3 1 890 7.0E-93
sp|B1YIS7|SYI_EXIS2 Isoleucine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=ileS PE=3 SV=1 1 869 2.0E-92
sp|A9NG38|SYI_ACHLI Isoleucine--tRNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=ileS PE=3 SV=1 1 795 4.0E-92
sp|Q72PR7|SYI_LEPIC Isoleucine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=ileS PE=3 SV=1 1 855 5.0E-92
sp|Q1MPH2|SYI_LAWIP Isoleucine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=ileS PE=3 SV=1 1 826 6.0E-92
sp|Q21HK3|SYI_SACD2 Isoleucine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ileS PE=3 SV=1 1 793 1.0E-91
sp|Q8F6I1|SYI_LEPIN Isoleucine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=ileS PE=3 SV=1 1 855 2.0E-91
sp|Q836V1|SYI_ENTFA Isoleucine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ileS PE=3 SV=1 1 790 2.0E-91
sp|Q053V3|SYI_LEPBL Isoleucine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=ileS PE=3 SV=1 1 914 8.0E-91
sp|Q04QS6|SYI_LEPBJ Isoleucine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ileS PE=3 SV=1 1 914 8.0E-91
sp|Q5FKU5|SYI_LACAC Isoleucine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=ileS PE=3 SV=1 1 790 1.0E-90
sp|Q747X9|SYI_GEOSL Isoleucine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ileS PE=3 SV=1 1 836 3.0E-90
sp|B3WDZ1|SYI_LACCB Isoleucine--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=ileS PE=3 SV=1 1 792 3.0E-89
sp|Q8R9L3|SYI_CALS4 Isoleucine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ileS PE=3 SV=1 1 820 3.0E-89
sp|A4XKR2|SYI_CALS8 Isoleucine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=ileS PE=3 SV=1 1 899 3.0E-89
sp|Q039Q9|SYI_LACC3 Isoleucine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=ileS PE=3 SV=1 1 792 4.0E-89
sp|Q49WX5|SYI_STAS1 Isoleucine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ileS PE=3 SV=1 1 867 6.0E-89
sp|A1RMM6|SYI_SHESW Isoleucine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=ileS PE=3 SV=1 1 795 1.0E-88
sp|Q65JV7|SYI_BACLD Isoleucine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ileS PE=3 SV=1 1 895 1.0E-88
sp|A4Y4A4|SYI_SHEPC Isoleucine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ileS PE=3 SV=1 1 795 1.0E-88
sp|Q9CEH8|SYI_LACLA Isoleucine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ileS PE=3 SV=1 1 793 2.0E-88
sp|Q0VSE1|SYI_ALCBS Isoleucine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ileS PE=3 SV=1 1 793 2.0E-88
sp|Q03QI3|SYI_LACBA Isoleucine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ileS PE=3 SV=1 1 825 2.0E-88
sp|A1S425|SYI_SHEAM Isoleucine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ileS PE=3 SV=1 1 795 3.0E-88
sp|Q9K9V0|SYI_BACHD Isoleucine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ileS PE=3 SV=1 1 816 3.0E-88
sp|Q8ER41|SYI1_OCEIH Isoleucine--tRNA ligase 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ileS1 PE=3 SV=1 1 902 3.0E-88
sp|Q8EBI4|SYI_SHEON Isoleucine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=ileS PE=3 SV=1 1 795 3.0E-88
sp|B2GB86|SYI_LACF3 Isoleucine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=ileS PE=3 SV=1 1 872 4.0E-88
sp|Q8PBG6|SYI_XANCP Isoleucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ileS PE=3 SV=1 1 892 6.0E-88
sp|Q4US40|SYI_XANC8 Isoleucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ileS PE=3 SV=1 1 892 6.0E-88
sp|B8J3R3|SYI_DESDA Isoleucine--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=ileS PE=3 SV=1 1 813 7.0E-88
sp|C0R112|SYI_BRAHW Isoleucine--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=ileS PE=3 SV=1 16 903 1.0E-87
sp|A3D1G5|SYI_SHEB5 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ileS PE=3 SV=1 1 795 1.0E-87
sp|B8EFC7|SYI_SHEB2 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=ileS PE=3 SV=1 1 795 1.0E-87
sp|B2VGR6|SYI_ERWT9 Isoleucine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ileS PE=3 SV=1 1 896 1.0E-87
sp|A6WKD4|SYI_SHEB8 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=ileS PE=3 SV=1 1 795 2.0E-87
sp|A9L4U7|SYI_SHEB9 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=ileS PE=3 SV=1 1 795 2.0E-87
sp|Q3A1R3|SYI_PELCD Isoleucine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ileS PE=3 SV=1 1 841 2.0E-87
sp|B0RY28|SYI_XANCB Isoleucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ileS PE=3 SV=1 1 892 3.0E-87
sp|B0TJA9|SYI_SHEHH Isoleucine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ileS PE=3 SV=1 1 795 3.0E-87
sp|B9EB60|SYI_MACCJ Isoleucine--tRNA ligase OS=Macrococcus caseolyticus (strain JCSC5402) GN=ileS PE=3 SV=1 1 818 4.0E-87
sp|A8H1H3|SYI_SHEPA Isoleucine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ileS PE=3 SV=1 1 795 5.0E-87
sp|Q67Q27|SYI_SYMTH Isoleucine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ileS PE=3 SV=1 1 844 9.0E-87
sp|A4VI60|SYI_PSEU5 Isoleucine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=ileS PE=3 SV=1 1 816 9.0E-87
sp|Q0HFY9|SYI_SHESM Isoleucine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=ileS PE=3 SV=1 1 795 2.0E-86
sp|A0KZZ1|SYI_SHESA Isoleucine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=ileS PE=3 SV=1 1 795 2.0E-86
sp|C5BQX2|SYI_TERTT Isoleucine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ileS PE=3 SV=1 1 793 2.0E-86
sp|B0JSP4|SYI_MICAN Isoleucine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=ileS PE=3 SV=1 1 891 2.0E-86
sp|Q98PQ2|SYI_MYCPU Isoleucine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ileS PE=3 SV=1 1 790 2.0E-86
sp|A8FSI2|SYI_SHESH Isoleucine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=ileS PE=3 SV=1 1 795 3.0E-86
sp|B2G6L2|SYI_LACRJ Isoleucine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=ileS PE=3 SV=1 1 804 3.0E-86
sp|Q0HS82|SYI_SHESR Isoleucine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=ileS PE=3 SV=1 1 795 3.0E-86
sp|Q605M7|SYI_METCA Isoleucine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ileS PE=3 SV=1 1 793 5.0E-86
sp|Q4L5P4|SYI_STAHJ Isoleucine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ileS PE=3 SV=1 1 867 6.0E-86
sp|B4U8K1|SYI_HYDS0 Isoleucine--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ileS PE=3 SV=1 1 897 6.0E-86
sp|A3QBX2|SYI_SHELP Isoleucine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ileS PE=3 SV=1 1 804 8.0E-86
sp|Q1WTA9|SYI_LACS1 Isoleucine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=ileS PE=3 SV=1 1 792 8.0E-86
sp|B9DPP7|SYI_STACT Isoleucine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=ileS PE=3 SV=1 1 905 9.0E-86
sp|B9MRZ5|SYI_CALBD Isoleucine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ileS PE=3 SV=1 1 887 1.0E-85
sp|Q04B65|SYI_LACDB Isoleucine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ileS PE=3 SV=1 1 837 3.0E-85
sp|A6Q4I1|SYI_NITSB Isoleucine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=ileS PE=3 SV=1 1 821 3.0E-85
sp|Q3J8W1|SYI_NITOC Isoleucine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ileS PE=3 SV=1 1 793 3.0E-85
sp|Q1GAS8|SYI_LACDA Isoleucine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ileS PE=3 SV=1 1 837 3.0E-85
sp|A1TYY9|SYI_MARHV Isoleucine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ileS PE=3 SV=1 1 803 4.0E-85
sp|Q846V6|SYI_STAEP Isoleucine--tRNA ligase OS=Staphylococcus epidermidis GN=ileS PE=3 SV=1 1 867 5.0E-85
sp|B8GQR1|SYI_THISH Isoleucine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=ileS PE=3 SV=1 1 843 5.0E-85
sp|Q8NX29|SYI_STAAW Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=ileS PE=3 SV=1 1 837 5.0E-85
sp|Q6GA19|SYI_STAAS Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=ileS PE=3 SV=1 1 837 5.0E-85
sp|B1KIT5|SYI_SHEWM Isoleucine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ileS PE=3 SV=1 1 795 6.0E-85
sp|B8CSC1|SYI_SHEPW Isoleucine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ileS PE=3 SV=1 1 795 6.0E-85
sp|B5Y235|SYI_KLEP3 Isoleucine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=ileS PE=3 SV=1 1 790 7.0E-85
sp|Q2YXH4|SYI_STAAB Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ileS PE=3 SV=1 1 837 8.0E-85
sp|Q8UHJ6|SYI_AGRFC Isoleucine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ileS PE=3 SV=1 1 862 8.0E-85
sp|P0DG43|SYI_STRPQ Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ileS PE=3 SV=1 1 793 1.0E-84
sp|P0DG42|SYI_STRP3 Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ileS PE=3 SV=1 1 793 1.0E-84
sp|Q5WFI3|SYI_BACSK Isoleucine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|Q5HPZ9|SYI_STAEQ Isoleucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ileS PE=3 SV=1 1 896 1.0E-84
sp|Q2S9T9|SYI_HAHCH Isoleucine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=ileS PE=3 SV=1 1 790 1.0E-84
sp|B0KM84|SYI_PSEPG Isoleucine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=ileS PE=3 SV=1 1 800 1.0E-84
sp|Q4A5K5|SYI_MYCS5 Isoleucine--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=ileS PE=3 SV=2 1 790 1.0E-84
sp|B0STE5|SYI_LEPBP Isoleucine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=ileS PE=3 SV=1 1 790 1.0E-84
sp|B0SBW4|SYI_LEPBA Isoleucine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=ileS PE=3 SV=1 1 790 1.0E-84
sp|Q6GHP2|SYI_STAAR Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|P41972|SYI1_STAAU Isoleucine--tRNA ligase OS=Staphylococcus aureus GN=ileS PE=1 SV=1 1 837 1.0E-84
sp|O66651|SYI_AQUAE Isoleucine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=ileS PE=3 SV=1 1 865 1.0E-84
sp|A5IY09|SYI_MYCAP Isoleucine--tRNA ligase OS=Mycoplasma agalactiae (strain PG2) GN=ileS PE=3 SV=1 1 883 1.0E-84
sp|A8Z3N1|SYI_STAAT Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|P67509|SYI_STAAN Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=ileS PE=1 SV=1 1 837 1.0E-84
sp|P67508|SYI_STAAM Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|A6QG93|SYI_STAAE Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|Q5HGN8|SYI_STAAC Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|A5IS79|SYI_STAA9 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|Q2FZ82|SYI_STAA8 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|Q2FHP4|SYI_STAA3 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|A6U113|SYI_STAA2 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|A7X1D8|SYI_STAA1 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ileS PE=3 SV=1 1 837 1.0E-84
sp|Q8CSX1|SYI_STAES Isoleucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ileS PE=3 SV=1 1 896 2.0E-84
sp|Q5H2E1|SYI_XANOR Isoleucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ileS PE=3 SV=1 1 892 2.0E-84
sp|Q2P5B0|SYI_XANOM Isoleucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ileS PE=3 SV=1 1 892 2.0E-84
sp|Q1I4S5|SYI_PSEE4 Isoleucine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=ileS PE=3 SV=1 1 800 2.0E-84
sp|A3MYB6|SYI_ACTP2 Isoleucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ileS PE=3 SV=1 1 797 2.0E-84
sp|Q6F175|SYI_MESFL Isoleucine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ileS PE=3 SV=1 1 639 2.0E-84
sp|Q8E6N1|SYI_STRA3 Isoleucine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ileS PE=3 SV=1 1 793 2.0E-84
sp|Q5FRI6|SYI_GLUOX Isoleucine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=ileS PE=3 SV=1 1 866 3.0E-84
sp|A5CX61|SYI_VESOH Isoleucine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=ileS PE=3 SV=1 1 796 4.0E-84
sp|Q65RQ2|SYI_MANSM Isoleucine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=ileS PE=3 SV=1 1 879 4.0E-84
sp|Q8E177|SYI_STRA5 Isoleucine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ileS PE=3 SV=1 1 793 5.0E-84
sp|Q3K2N4|SYI_STRA1 Isoleucine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ileS PE=3 SV=1 1 793 5.0E-84
sp|C6BV89|SYI_DESAD Isoleucine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ileS PE=3 SV=1 1 894 5.0E-84
sp|Q38XM0|SYI_LACSS Isoleucine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ileS PE=3 SV=1 1 817 5.0E-84
sp|A5VY52|SYI_PSEP1 Isoleucine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ileS PE=3 SV=1 1 800 5.0E-84
sp|Q88Q92|SYI_PSEPK Isoleucine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=ileS PE=3 SV=1 1 800 5.0E-84
sp|B3GZN4|SYI_ACTP7 Isoleucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ileS PE=3 SV=1 1 797 8.0E-84
sp|Q8PN19|SYI_XANAC Isoleucine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ileS PE=3 SV=1 1 892 9.0E-84
sp|Q8FLB7|SYI_ECOL6 Isoleucine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ileS PE=3 SV=1 1 897 1.0E-83
sp|B7MNN1|SYI_ECO81 Isoleucine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=ileS PE=3 SV=1 1 897 1.0E-83
sp|B9L8Z9|SYI_NAUPA Isoleucine--tRNA ligase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=ileS PE=3 SV=1 1 716 1.0E-83
sp|B7UI71|SYI_ECO27 Isoleucine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ileS PE=3 SV=1 1 790 1.0E-83
sp|Q0TLW5|SYI_ECOL5 Isoleucine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ileS PE=3 SV=1 1 790 1.0E-83
sp|B1LFV6|SYI_ECOSM Isoleucine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ileS PE=3 SV=1 1 897 1.0E-83
sp|B7NHD0|SYI_ECO7I Isoleucine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ileS PE=3 SV=1 1 897 1.0E-83
sp|Q1RGH6|SYI_ECOUT Isoleucine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=ileS PE=3 SV=1 1 897 2.0E-83
sp|A1A774|SYI_ECOK1 Isoleucine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=ileS PE=3 SV=1 1 897 2.0E-83
sp|B7MAE6|SYI_ECO45 Isoleucine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ileS PE=3 SV=1 1 897 2.0E-83
sp|A1JJE1|SYI_YERE8 Isoleucine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ileS PE=3 SV=1 1 855 2.0E-83
sp|Q326J7|SYI_SHIBS Isoleucine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=ileS PE=3 SV=1 1 790 2.0E-83
sp|B1JF83|SYI_PSEPW Isoleucine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=ileS PE=3 SV=1 1 800 2.0E-83
sp|Q9HVM4|SYI_PSEAE Isoleucine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ileS PE=3 SV=1 1 795 2.0E-83
sp|B7V0A3|SYI_PSEA8 Isoleucine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=ileS PE=3 SV=1 1 795 3.0E-83
sp|A4XQV5|SYI_PSEMY Isoleucine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=ileS PE=3 SV=1 1 800 3.0E-83
sp|A8ALT6|SYI_CITK8 Isoleucine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ileS PE=3 SV=1 1 790 4.0E-83
sp|B1IRE9|SYI_ECOLC Isoleucine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ileS PE=3 SV=1 1 897 4.0E-83
sp|B7LVN2|SYI_ESCF3 Isoleucine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ileS PE=3 SV=1 1 897 4.0E-83
sp|A7ZHB5|SYI_ECO24 Isoleucine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ileS PE=3 SV=1 1 897 4.0E-83
sp|B0UV12|SYI_HISS2 Isoleucine--tRNA ligase OS=Histophilus somni (strain 2336) GN=ileS PE=3 SV=1 1 799 5.0E-83
sp|Q3BW42|SYI_XANC5 Isoleucine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ileS PE=3 SV=1 1 892 5.0E-83
sp|C1CFN0|SYI_STRZJ Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=ileS PE=3 SV=1 1 818 5.0E-83
sp|Q32K71|SYI_SHIDS Isoleucine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ileS PE=3 SV=1 1 897 6.0E-83
sp|Q820M6|SYI_NITEU Isoleucine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ileS PE=3 SV=1 1 887 6.0E-83
sp|Q3Z5Y4|SYI_SHISS Isoleucine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=ileS PE=3 SV=1 1 790 6.0E-83
sp|B6HZ21|SYI_ECOSE Isoleucine--tRNA ligase OS=Escherichia coli (strain SE11) GN=ileS PE=3 SV=1 1 790 6.0E-83
sp|P00956|SYI_ECOLI Isoleucine--tRNA ligase OS=Escherichia coli (strain K12) GN=ileS PE=1 SV=5 1 790 6.0E-83
sp|B1XBF1|SYI_ECODH Isoleucine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=ileS PE=3 SV=1 1 790 6.0E-83
sp|C4ZPV2|SYI_ECOBW Isoleucine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ileS PE=3 SV=1 1 790 6.0E-83
sp|B7M0C2|SYI_ECO8A Isoleucine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=ileS PE=3 SV=1 1 790 6.0E-83
sp|B7L4E8|SYI_ECO55 Isoleucine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=ileS PE=3 SV=1 1 790 6.0E-83
sp|A1VCU3|SYI_DESVV Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ileS PE=3 SV=1 1 831 6.0E-83
sp|B2U245|SYI_SHIB3 Isoleucine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ileS PE=3 SV=1 1 790 7.0E-83
sp|Q83MH2|SYI_SHIFL Isoleucine--tRNA ligase OS=Shigella flexneri GN=ileS PE=3 SV=1 1 897 7.0E-83
sp|Q02GB7|SYI_PSEAB Isoleucine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ileS PE=3 SV=1 1 795 9.0E-83
sp|Q72AR5|SYI_DESVH Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ileS PE=3 SV=1 1 831 9.0E-83
sp|B5E709|SYI_STRP4 Isoleucine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=ileS PE=3 SV=1 1 894 1.0E-82
sp|P0CB61|SYI_STRPN Isoleucine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ileS PE=3 SV=1 1 818 1.0E-82
sp|Q0BNB5|SYI_FRATO Isoleucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ileS PE=3 SV=1 1 872 1.0E-82
sp|Q2A4Z4|SYI_FRATH Isoleucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ileS PE=3 SV=1 1 872 1.0E-82
sp|A7NAD2|SYI_FRATF Isoleucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ileS PE=3 SV=1 1 872 1.0E-82
sp|A8AW24|SYI_STRGC Isoleucine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=ileS PE=3 SV=1 1 890 1.0E-82
sp|Q7VP34|SYI_HAEDU Isoleucine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ileS PE=3 SV=1 1 868 1.0E-82
sp|B1I721|SYI_STRPI Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=ileS PE=3 SV=1 1 818 1.0E-82
sp|B7N7Q0|SYI_ECOLU Isoleucine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ileS PE=3 SV=1 1 790 1.0E-82
sp|Q48SL8|SYI_STRPM Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ileS PE=3 SV=1 1 636 1.0E-82
sp|Q5XB14|SYI_STRP6 Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ileS PE=3 SV=1 1 636 2.0E-82
sp|Q8DNW4|SYI_STRR6 Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ileS PE=3 SV=1 1 818 2.0E-82
sp|Q04JB0|SYI_STRP2 Isoleucine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ileS PE=3 SV=1 1 818 2.0E-82
sp|A1WY38|SYI_HALHL Isoleucine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ileS PE=3 SV=1 1 800 2.0E-82
sp|C1CSS4|SYI_STRZT Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=ileS PE=3 SV=1 1 818 2.0E-82
sp|B5BLL0|SYI_SALPK Isoleucine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=ileS PE=3 SV=1 1 794 2.0E-82
sp|Q5PDL9|SYI_SALPA Isoleucine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ileS PE=3 SV=1 1 794 2.0E-82
sp|B2IRR4|SYI_STRPS Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=ileS PE=3 SV=1 1 818 2.0E-82
sp|B8HMX3|SYI_CYAP4 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ileS PE=3 SV=1 1 824 3.0E-82
sp|Q03EY9|SYI_PEDPA Isoleucine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ileS PE=3 SV=1 1 859 3.0E-82
sp|A1SZP3|SYI_PSYIN Isoleucine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=ileS PE=3 SV=1 1 793 3.0E-82
sp|B8ZM55|SYI_STRPJ Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=ileS PE=3 SV=1 1 818 3.0E-82
sp|Q4FPA9|SYI_PELUB Isoleucine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=ileS PE=3 SV=1 1 897 4.0E-82
sp|C1C8P8|SYI_STRP7 Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=ileS PE=3 SV=1 1 889 4.0E-82
sp|P18330|SYI1_PSEFL Isoleucine--tRNA ligase 1 OS=Pseudomonas fluorescens GN=ileS1 PE=3 SV=2 1 848 5.0E-82
sp|B5YYB8|SYI_ECO5E Isoleucine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ileS PE=3 SV=1 1 897 5.0E-82
sp|Q8XA49|SYI_ECO57 Isoleucine--tRNA ligase OS=Escherichia coli O157:H7 GN=ileS PE=3 SV=1 1 897 5.0E-82
sp|Q5M4X2|SYI_STRT2 Isoleucine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ileS PE=3 SV=1 1 793 5.0E-82
sp|Q5M0C5|SYI_STRT1 Isoleucine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ileS PE=3 SV=1 1 793 5.0E-82
sp|Q03L88|SYI_STRTD Isoleucine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ileS PE=3 SV=1 1 793 5.0E-82
sp|Q5NGD0|SYI_FRATT Isoleucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ileS PE=3 SV=1 1 872 6.0E-82
sp|Q14HT2|SYI_FRAT1 Isoleucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ileS PE=3 SV=1 1 872 6.0E-82
sp|Q0I1V8|SYI_HAES1 Isoleucine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=ileS PE=3 SV=1 1 799 7.0E-82
sp|Q88V89|SYI_LACPL Isoleucine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ileS PE=3 SV=1 1 833 7.0E-82
sp|B5RF43|SYI_SALG2 Isoleucine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ileS PE=3 SV=1 1 790 8.0E-82
sp|B5R1N6|SYI_SALEP Isoleucine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=ileS PE=3 SV=1 1 790 8.0E-82
sp|Q57TL5|SYI_SALCH Isoleucine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=ileS PE=3 SV=2 1 790 8.0E-82
sp|A6VBU7|SYI_PSEA7 Isoleucine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=ileS PE=3 SV=1 1 795 8.0E-82
sp|C1CLZ8|SYI_STRZP Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=ileS PE=3 SV=1 1 818 8.0E-82
sp|B4F2T5|SYI_PROMH Isoleucine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=ileS PE=3 SV=1 1 874 8.0E-82
sp|Q8Z9N2|SYI_SALTI Isoleucine--tRNA ligase OS=Salmonella typhi GN=ileS PE=3 SV=1 1 790 9.0E-82
sp|A4IYP1|SYI_FRATW Isoleucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ileS PE=3 SV=1 1 872 9.0E-82
sp|A7ZVX4|SYI_ECOHS Isoleucine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=ileS PE=3 SV=1 1 790 1.0E-81
sp|Q7N8X2|SYI_PHOLL Isoleucine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ileS PE=3 SV=1 1 874 1.0E-81
sp|Q99YW3|SYI_STRP1 Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=ileS PE=3 SV=1 1 636 1.0E-81
sp|Q30ZF7|SYI_DESAG Isoleucine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=ileS PE=3 SV=1 1 801 1.0E-81
sp|C3KDX4|SYI_PSEFS Isoleucine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=ileS PE=3 SV=1 1 848 1.0E-81
sp|B1JKZ8|SYI_YERPY Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ileS PE=3 SV=1 1 855 1.0E-81
sp|Q66ES4|SYI_YERPS Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ileS PE=3 SV=1 1 855 1.0E-81
sp|A4TQF3|SYI_YERPP Isoleucine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=ileS PE=3 SV=1 1 855 1.0E-81
sp|Q1CMV1|SYI_YERPN Isoleucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ileS PE=3 SV=1 1 855 1.0E-81
sp|A9R008|SYI_YERPG Isoleucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ileS PE=3 SV=1 1 855 1.0E-81
sp|Q8ZIM0|SYI_YERPE Isoleucine--tRNA ligase OS=Yersinia pestis GN=ileS PE=3 SV=1 1 855 1.0E-81
sp|B2K3M6|SYI_YERPB Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ileS PE=3 SV=1 1 855 1.0E-81
sp|Q1C0J3|SYI_YERPA Isoleucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ileS PE=3 SV=1 1 855 1.0E-81
sp|B2SF88|SYI_FRATM Isoleucine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ileS PE=3 SV=1 1 872 1.0E-81
sp|Q6MT28|SYI_MYCMS Isoleucine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=ileS PE=3 SV=1 1 812 1.0E-81
sp|Q8ZRZ0|SYI_SALTY Isoleucine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ileS PE=3 SV=1 1 790 1.0E-81
sp|B0TZQ5|SYI_FRAP2 Isoleucine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ileS PE=3 SV=1 1 872 2.0E-81
sp|A0Q529|SYI_FRATN Isoleucine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=ileS PE=3 SV=1 1 933 2.0E-81
sp|Q602B7|SYI_MYCH2 Isoleucine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=ileS PE=3 SV=1 1 790 2.0E-81
sp|Q3K6L5|SYI_PSEPF Isoleucine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ileS PE=3 SV=1 1 848 3.0E-81
sp|Q8P068|SYI_STRP8 Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ileS PE=3 SV=1 1 636 3.0E-81
sp|A1AW09|SYI_RUTMC Isoleucine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=ileS PE=3 SV=1 1 793 3.0E-81
sp|B0U3Q9|SYI_XYLFM Isoleucine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=ileS PE=3 SV=1 1 790 3.0E-81
sp|Q0AAD1|SYI_ALKEH Isoleucine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ileS PE=3 SV=1 1 803 4.0E-81
sp|Q4A8Y0|SYI_MYCH7 Isoleucine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=ileS PE=3 SV=2 1 790 4.0E-81
sp|Q3IEA2|SYI_PSEHT Isoleucine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ileS PE=3 SV=1 1 804 4.0E-81
sp|Q6G0K6|SYI_BARQU Isoleucine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=ileS PE=3 SV=1 1 890 5.0E-81
sp|Q4ZYJ4|SYI_PSEU2 Isoleucine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ileS PE=3 SV=1 1 876 5.0E-81
sp|Q4AAS1|SYI_MYCHJ Isoleucine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=ileS PE=3 SV=2 1 790 5.0E-81
sp|C1DPH5|SYI_AZOVD Isoleucine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ileS PE=3 SV=1 1 816 7.0E-81
sp|Q9CKF7|SYI_PASMU Isoleucine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=ileS PE=3 SV=1 1 876 8.0E-81
sp|Q9AAA5|SYI_CAUCR Isoleucine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ileS PE=3 SV=1 1 868 1.0E-80
sp|Q0IDA5|SYI_SYNS3 Isoleucine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=ileS PE=3 SV=1 12 856 1.0E-80
sp|Q889E4|SYI_PSESM Isoleucine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ileS PE=3 SV=1 1 876 1.0E-80
sp|Q9PAS7|SYI_XYLFA Isoleucine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=ileS PE=3 SV=1 1 790 1.0E-80
sp|Q7U9G9|SYI_SYNPX Isoleucine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=ileS PE=3 SV=1 1 856 1.0E-80
sp|Q6G4S5|SYI_BARHE Isoleucine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ileS PE=3 SV=1 1 891 2.0E-80
sp|Q3SHS3|SYI_THIDA Isoleucine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ileS PE=3 SV=1 1 862 2.0E-80
sp|C6DF04|SYI_PECCP Isoleucine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ileS PE=3 SV=1 1 855 2.0E-80
sp|B7K5H5|SYI_CYAP8 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=ileS PE=3 SV=1 8 796 2.0E-80
sp|A7FMD7|SYI_YERP3 Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ileS PE=3 SV=1 1 855 2.0E-80
sp|P73505|SYI_SYNY3 Isoleucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ileS PE=3 SV=1 1 796 3.0E-80
sp|A5EWT0|SYI_DICNV Isoleucine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=ileS PE=3 SV=1 1 795 3.0E-80
sp|Q8EUN9|SYI_MYCPE Isoleucine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=ileS PE=3 SV=1 1 818 3.0E-80
sp|Q4QLU5|SYI_HAEI8 Isoleucine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=ileS PE=3 SV=1 1 867 3.0E-80
sp|A3CLP4|SYI_STRSV Isoleucine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=ileS PE=3 SV=1 1 837 3.0E-80
sp|Q87BL5|SYI_XYLFT Isoleucine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ileS PE=3 SV=1 1 790 3.0E-80
sp|B2I6V2|SYI_XYLF2 Isoleucine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=ileS PE=3 SV=1 1 790 3.0E-80
sp|Q48NK6|SYI_PSE14 Isoleucine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ileS PE=3 SV=1 1 876 4.0E-80
sp|A5UDA6|SYI_HAEIE Isoleucine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=ileS PE=3 SV=1 1 887 4.0E-80
sp|Q5P221|SYI_AROAE Isoleucine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=ileS PE=3 SV=1 1 790 4.0E-80
sp|A8G9L4|SYI_SERP5 Isoleucine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=ileS PE=3 SV=1 1 875 7.0E-80
sp|P43824|SYI_HAEIN Isoleucine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ileS PE=3 SV=2 1 867 8.0E-80
sp|A1K4R7|SYI_AZOSB Isoleucine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=ileS PE=3 SV=1 1 879 9.0E-80
sp|A5UIA3|SYI_HAEIG Isoleucine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=ileS PE=3 SV=1 1 887 1.0E-79
sp|Q8DVD3|SYI_STRMU Isoleucine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ileS PE=3 SV=1 1 902 2.0E-79
sp|C3LST7|SYI_VIBCM Isoleucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ileS PE=3 SV=1 1 790 4.0E-79
sp|Q9KU47|SYI_VIBCH Isoleucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ileS PE=3 SV=1 1 790 4.0E-79
sp|B8F5E2|SYI_HAEPS Isoleucine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=ileS PE=3 SV=1 1 878 5.0E-79
sp|Q7NBG0|SYI_MYCGA Isoleucine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=ileS PE=3 SV=2 1 635 8.0E-79
sp|Q7VXK3|SYI_BORPE Isoleucine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ileS PE=3 SV=1 1 790 1.0E-78
sp|Q7MAL0|SYI_WOLSU Isoleucine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ileS PE=3 SV=1 1 787 1.0E-78
sp|Q5NQQ7|SYI_ZYMMO Isoleucine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ileS PE=3 SV=1 1 884 2.0E-78
sp|Q6D0C3|SYI_PECAS Isoleucine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ileS PE=3 SV=1 1 855 2.0E-78
sp|B7KFT1|SYI_CYAP7 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=ileS PE=3 SV=1 1 796 2.0E-78
sp|Q39DM8|SYI_BURL3 Isoleucine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ileS PE=3 SV=1 1 795 2.0E-78
sp|A5F8Z3|SYI_VIBC3 Isoleucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ileS PE=3 SV=1 1 790 3.0E-78
sp|Q5N1G1|SYI_SYNP6 Isoleucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ileS PE=3 SV=1 1 636 3.0E-78
sp|B2FTJ0|SYI_STRMK Isoleucine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=ileS PE=3 SV=1 1 892 4.0E-78
sp|Q4K5U4|SYI_PSEF5 Isoleucine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ileS PE=3 SV=1 1 848 4.0E-78
sp|Q2L2K5|SYI_BORA1 Isoleucine--tRNA ligase OS=Bordetella avium (strain 197N) GN=ileS PE=3 SV=1 1 790 6.0E-78
sp|Q7W8Z2|SYI_BORPA Isoleucine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ileS PE=3 SV=1 1 790 7.0E-78
sp|B8DPD6|SYI_DESVM Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ileS PE=3 SV=1 1 801 9.0E-78
sp|Q2T0H3|SYI_BURTA Isoleucine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ileS PE=3 SV=1 1 796 1.0E-77
sp|Q7WKD5|SYI_BORBR Isoleucine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ileS PE=3 SV=1 1 790 1.0E-77
sp|A7MIM3|SYI_CROS8 Isoleucine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ileS PE=3 SV=1 1 790 1.0E-77
sp|Q47BK5|SYI_DECAR Isoleucine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=ileS PE=3 SV=1 1 790 1.0E-77
sp|B4SP18|SYI_STRM5 Isoleucine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=ileS PE=3 SV=1 1 892 1.0E-77
sp|A9AGN6|SYI_BURM1 Isoleucine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ileS PE=3 SV=1 1 795 1.0E-77
sp|Q8YXY3|SYI_NOSS1 Isoleucine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ileS PE=3 SV=1 1 796 2.0E-77
sp|Q89AU9|SYI_BUCBP Isoleucine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ileS PE=3 SV=1 1 790 3.0E-77
sp|Q6YR34|SYI_ONYPE Isoleucine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=ileS PE=3 SV=1 1 672 3.0E-77
sp|Q83EC9|SYI_COXBU Isoleucine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ileS PE=3 SV=1 1 790 3.0E-77
sp|B6J1S2|SYI_COXB2 Isoleucine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=ileS PE=3 SV=1 1 790 4.0E-77
sp|B6J9J5|SYI_COXB1 Isoleucine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=ileS PE=3 SV=1 1 790 4.0E-77
sp|B2IZP5|SYI_NOSP7 Isoleucine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ileS PE=3 SV=1 1 796 4.0E-77
sp|B4E8Z7|SYI_BURCJ Isoleucine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ileS PE=3 SV=1 1 795 5.0E-77
sp|A0KG39|SYI_AERHH Isoleucine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ileS PE=3 SV=1 1 795 5.0E-77
sp|Q4FUS5|SYI_PSYA2 Isoleucine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ileS PE=3 SV=1 1 790 6.0E-77
sp|B3DYQ6|SYI_METI4 Isoleucine--tRNA ligase OS=Methylacidiphilum infernorum (isolate V4) GN=ileS PE=3 SV=1 1 795 6.0E-77
sp|A6QB84|SYI_SULNB Isoleucine--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=ileS PE=3 SV=1 1 797 6.0E-77
sp|Q13UW2|SYI_BURXL Isoleucine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=ileS PE=3 SV=1 1 843 7.0E-77
sp|Q2NVY6|SYI_SODGM Isoleucine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=ileS PE=3 SV=1 1 790 7.0E-77
sp|P0C123|SYI_BRUAB Isoleucine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=ileS PE=3 SV=1 1 639 7.0E-77
sp|P0C124|SYI_BRUA2 Isoleucine--tRNA ligase OS=Brucella abortus (strain 2308) GN=ileS PE=3 SV=1 1 639 7.0E-77
sp|B1WVA3|SYI_CYAA5 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=ileS PE=3 SV=1 1 796 8.0E-77
sp|Q7NF75|SYI_GLOVI Isoleucine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=ileS PE=3 SV=1 10 793 9.0E-77
sp|A4JH32|SYI_BURVG Isoleucine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ileS PE=3 SV=1 1 795 1.0E-76
sp|B1JXC3|SYI_BURCC Isoleucine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=ileS PE=3 SV=1 1 795 1.0E-76
sp|Q30SH2|SYI_SULDN Isoleucine--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=ileS PE=3 SV=1 1 800 1.0E-76
sp|A9NBM5|SYI_COXBR Isoleucine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ileS PE=3 SV=1 1 790 1.0E-76
sp|Q8YB57|SYI_BRUME Isoleucine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ileS PE=3 SV=1 1 639 1.0E-76
sp|A9KEI8|SYI_COXBN Isoleucine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ileS PE=3 SV=1 1 790 1.0E-76
sp|A4G3E6|SYI_HERAR Isoleucine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=ileS PE=3 SV=1 1 831 1.0E-76
sp|Q8FX81|SYI_BRUSU Isoleucine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=ileS PE=3 SV=1 1 639 1.0E-76
sp|A0K9T5|SYI_BURCH Isoleucine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=ileS PE=3 SV=1 1 795 2.0E-76
sp|Q1BUA1|SYI_BURCA Isoleucine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=ileS PE=3 SV=1 1 795 2.0E-76
sp|Q5X6G6|SYI_LEGPA Isoleucine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=ileS PE=3 SV=1 1 790 2.0E-76
sp|Q0BCK8|SYI_BURCM Isoleucine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ileS PE=3 SV=1 1 795 2.0E-76
sp|B1YVA4|SYI_BURA4 Isoleucine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=ileS PE=3 SV=1 1 795 3.0E-76
sp|A5IFX5|SYI_LEGPC Isoleucine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=ileS PE=3 SV=1 1 790 3.0E-76
sp|Q983N4|SYI_RHILO Isoleucine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=ileS PE=3 SV=2 1 817 3.0E-76
sp|Q6LUL1|SYI_PHOPR Isoleucine--tRNA ligase OS=Photobacterium profundum GN=ileS PE=3 SV=1 1 875 4.0E-76
sp|C5B7M4|SYI_EDWI9 Isoleucine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=ileS PE=3 SV=1 1 855 4.0E-76
sp|Q63WI3|SYI1_BURPS Isoleucine--tRNA ligase 1 OS=Burkholderia pseudomallei (strain K96243) GN=ileS1 PE=3 SV=1 1 796 5.0E-76
sp|C1DCX2|SYI_LARHH Isoleucine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=ileS PE=3 SV=1 1 793 5.0E-76
sp|Q486U0|SYI_COLP3 Isoleucine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ileS PE=3 SV=1 1 811 6.0E-76
sp|Q8DES7|SYI_VIBVU Isoleucine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=ileS PE=3 SV=1 1 799 6.0E-76
sp|Q7MNM8|SYI_VIBVY Isoleucine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=ileS PE=3 SV=1 1 799 6.0E-76
sp|B2T6I7|SYI_BURPP Isoleucine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ileS PE=3 SV=1 1 843 6.0E-76
sp|B2JDY9|SYI_BURP8 Isoleucine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ileS PE=3 SV=1 1 845 7.0E-76
sp|Q62HL4|SYI1_BURMA Isoleucine--tRNA ligase 1 OS=Burkholderia mallei (strain ATCC 23344) GN=ileS1 PE=3 SV=1 1 796 8.0E-76
sp|Q1LSS9|SYI_BAUCH Isoleucine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=ileS PE=3 SV=1 1 790 1.0E-75
sp|Q5WXX1|SYI_LEGPL Isoleucine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=ileS PE=3 SV=1 1 790 1.0E-75
sp|Q5ZWZ6|SYI_LEGPH Isoleucine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ileS PE=3 SV=1 1 790 2.0E-75
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0000166 nucleotide binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0005488 binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0006399 tRNA metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0043039 tRNA aminoacylation No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0043038 amino acid activation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4010
MSVNFPKEEEATIERWRNIKAFHRQLELSAGRPRYTFYDGPPFATGLPHYGHLLASTIKDIIPRYWSMKGYHVER
RFGWDTHGLPIEHEIDKKLGISGKAAVTQFGIEQYNAECRSIVMRFSQEWRTTIERLGRWIDFDNDYKGLHADSF
LICKTMDPKFMESLWWVFKQLFDKGQVYQGYRVMPYSTVLTTALSNFEANQNYQDVNDPAVVVSFPLLDYSDVHL
LAWTTTPWTLPSHTGLVVNPEFEYVKIYDKESCKLYILLEKLLGTLYKDPKKAKFTIVDKLRGKQMVGWRYKPLF
GYFYDEFKDVGFRVFGGNYVTDESGTGIVHQAPAFGEDDYNVALQAGVINEQRPPPDPVDDTGHFTDRVPDFAGM
HVKDADKHIIKHLKNIDRLVIDSQIRHSYPMCPRSDTPLIYRAVPSWFIRIPEIIPDMLKNIEGSHWVPSFVKER
RFASWIANARDWNVGRNRYWGTPIPLWVSEDLEEHVCVGSIEELRELSGYEGDLTDIHRDKIDHITIPSTKGKGS
LRRIDEVFDCWFESGSMPYACQHYPFENIDRFNQSFPGDFIAEGLDQTRGWFYTLLVLGTHLFGCSPFQNCVVNG
IVLAEDGKKMSKRLKNYPDPMLIMEKYGSDALRLYLINSPVVRAEPLRFKEAGVKEVVQKVLLPLWNSFKFFQNQ
TALLKKVQGFDYQWSPKNGVRNTNVMDRWILASCQSLLQFVNEEMRGYRLYTVVPRLLELIDNTTNWYIRFNRRR
LKGENGLQDTLCALDALFEVLYTLCRGLAPFTPFLADNIYLKLLPHIPNELHDFDTRSVHFLPFPEVRQELFDAD
VERRVARMQRVIELGRVSRERRGVSLKTPLRSLVVIHHNQQFLEDVGELKSYVTEELNLRELILSGDEANYNVQF
SVTADWPVLGKKLRKDMARVKKGLPGLASEQVKQYLRDKEIWVDGIRLEEGDLVVRRGLDDNSASKSLEINSDNE
VLTILDAAIYPELAQEGVAREIINRVQRLRKKAGLQATDDVRMDYLVLSDPDGVGLSSILPSHAAAFEKTLRRPL
ELFDDGAGEGEVIVEEKQEVQRATILLRLLRI*
Coding >Hirsu2|4010
ATGTCCGTCAATTTCCCCAAGGAAGAGGAGGCTACCATCGAGCGATGGCGAAACATAAAGGCTTTTCATCGTCAG
CTTGAATTGTCTGCTGGCCGGCCGCGGTACACGTTCTACGATGGACCACCGTTCGCAACTGGACTACCTCATTAT
GGTCATCTGCTGGCATCTACTATTAAAGATATCATACCACGTTATTGGTCTATGAAAGGCTATCACGTCGAGCGT
CGCTTTGGCTGGGACACTCATGGCCTCCCAATCGAGCATGAGATCGATAAGAAGCTGGGCATATCTGGCAAGGCT
GCTGTTACCCAGTTTGGCATCGAGCAATACAATGCGGAGTGCAGGTCAATAGTCATGAGGTTTTCGCAGGAGTGG
CGAACAACGATCGAACGTCTTGGCCGTTGGATAGATTTTGACAACGATTACAAGGGTCTGCATGCTGACAGTTTT
CTTATCTGCAAGACCATGGACCCTAAATTTATGGAATCATTGTGGTGGGTATTCAAGCAGTTGTTCGACAAGGGC
CAAGTCTATCAGGGATATCGTGTTATGCCCTACTCGACAGTTCTCACAACTGCATTGAGCAACTTCGAAGCAAAC
CAGAATTACCAAGATGTCAACGATCCTGCTGTGGTCGTGTCCTTTCCCCTATTGGACTACTCGGACGTCCATCTC
CTGGCCTGGACTACAACCCCCTGGACTCTTCCCTCCCACACTGGCTTAGTTGTGAATCCGGAATTCGAATATGTC
AAAATATACGACAAGGAATCCTGCAAATTGTACATTTTACTGGAGAAATTGCTTGGGACTCTCTACAAGGACCCC
AAGAAAGCCAAGTTTACCATTGTGGACAAGCTTCGGGGTAAGCAGATGGTCGGCTGGCGATACAAGCCATTGTTT
GGTTACTTCTACGATGAGTTTAAAGATGTTGGGTTTCGGGTCTTCGGCGGTAACTACGTGACGGACGAGAGCGGT
ACTGGAATTGTTCACCAGGCCCCAGCATTTGGAGAAGATGACTACAATGTCGCTCTGCAGGCCGGAGTCATCAAC
GAGCAGCGACCCCCCCCTGATCCAGTTGACGACACAGGCCATTTCACTGACCGAGTCCCTGACTTTGCTGGCATG
CACGTCAAAGATGCGGACAAGCATATCATTAAGCATTTAAAGAACATTGACCGTTTAGTGATCGATTCACAGATC
AGACACTCGTACCCGATGTGCCCTCGATCTGATACGCCTCTCATTTACCGAGCTGTTCCTTCATGGTTCATTCGC
ATACCTGAAATCATTCCTGATATGCTAAAAAATATAGAGGGATCTCACTGGGTTCCGTCCTTTGTCAAAGAGCGT
CGTTTCGCCAGCTGGATTGCCAATGCCCGCGACTGGAACGTCGGGAGAAACCGCTATTGGGGTACGCCCATTCCT
CTCTGGGTCAGCGAAGACTTGGAGGAGCATGTCTGTGTCGGCAGCATCGAAGAATTGCGGGAATTAAGCGGCTAC
GAGGGAGATTTGACGGACATTCATCGCGACAAAATCGATCACATCACAATTCCCAGTACCAAAGGCAAAGGGAGT
CTGCGGCGAATTGACGAAGTGTTCGATTGCTGGTTTGAGTCTGGTAGCATGCCGTACGCCTGCCAGCACTACCCA
TTCGAGAACATTGACAGGTTCAATCAGTCGTTCCCAGGAGACTTTATCGCTGAGGGCCTAGACCAAACAAGAGGG
TGGTTTTACACGCTTCTCGTGCTAGGCACACATCTCTTTGGCTGTTCGCCCTTTCAAAATTGTGTTGTCAATGGC
ATTGTGCTTGCCGAAGATGGGAAGAAGATGTCAAAGCGATTGAAAAATTATCCGGATCCAATGTTGATAATGGAG
AAGTACGGTTCGGATGCTCTTCGCCTCTATCTCATCAACTCTCCCGTGGTCAGAGCAGAGCCTCTACGATTTAAA
GAAGCCGGTGTAAAAGAAGTTGTTCAGAAGGTCCTACTGCCTCTGTGGAATAGCTTCAAGTTCTTTCAAAACCAA
ACAGCCCTTCTGAAAAAGGTTCAAGGCTTTGATTACCAGTGGAGTCCCAAGAATGGAGTGCGAAACACGAATGTC
ATGGATCGATGGATTTTGGCAAGCTGCCAGAGTCTCCTGCAATTCGTGAACGAAGAGATGCGAGGCTATCGTCTA
TACACCGTTGTTCCCCGACTCCTTGAGCTCATCGATAACACCACGAATTGGTACATACGCTTCAACCGTCGAAGA
CTCAAGGGGGAAAATGGTCTTCAAGACACTTTGTGTGCCCTCGATGCTCTTTTCGAGGTCTTGTACACACTGTGC
AGAGGCCTAGCGCCTTTTACTCCATTTTTGGCGGACAATATTTACCTGAAGCTCCTTCCGCATATTCCGAATGAG
CTCCATGATTTTGATACTCGAAGCGTCCACTTTTTACCCTTTCCGGAAGTGCGGCAGGAACTTTTCGATGCTGAT
GTGGAGAGAAGGGTAGCAAGAATGCAGCGCGTCATCGAACTGGGTCGGGTTTCAAGAGAGAGGAGAGGCGTCAGT
CTCAAGACACCATTGAGGAGCTTAGTGGTGATCCATCATAATCAGCAATTCTTGGAGGACGTAGGCGAGCTAAAA
AGCTACGTCACGGAGGAGCTCAACCTCCGAGAACTTATATTGTCTGGGGATGAAGCCAATTACAATGTCCAATTC
AGCGTCACTGCTGACTGGCCAGTCTTGGGTAAGAAGCTCAGAAAAGACATGGCACGCGTTAAAAAGGGGCTTCCG
GGTCTGGCCAGCGAACAGGTCAAGCAATATCTTCGAGATAAGGAAATATGGGTGGATGGCATACGATTGGAGGAA
GGCGATCTCGTCGTTCGTCGGGGACTCGATGACAATTCTGCTTCGAAGTCATTAGAGATCAACTCGGACAACGAA
GTGCTGACAATTCTAGATGCCGCGATATATCCTGAACTGGCCCAAGAGGGTGTAGCTCGGGAGATAATCAACCGA
GTGCAACGCCTCCGCAAAAAGGCTGGTCTTCAGGCTACGGACGATGTCAGGATGGACTACCTGGTGCTGTCCGAT
CCGGATGGAGTGGGCCTATCATCGATACTGCCCTCCCATGCTGCTGCCTTTGAGAAGACTTTGCGGAGACCACTT
GAGCTATTCGACGACGGGGCTGGTGAGGGCGAAGTCATCGTCGAGGAAAAACAGGAGGTGCAACGGGCGACAATC
TTGCTTCGCCTTCTTCGGATATAA
Transcript >Hirsu2|4010
ATGTCCGTCAATTTCCCCAAGGAAGAGGAGGCTACCATCGAGCGATGGCGAAACATAAAGGCTTTTCATCGTCAG
CTTGAATTGTCTGCTGGCCGGCCGCGGTACACGTTCTACGATGGACCACCGTTCGCAACTGGACTACCTCATTAT
GGTCATCTGCTGGCATCTACTATTAAAGATATCATACCACGTTATTGGTCTATGAAAGGCTATCACGTCGAGCGT
CGCTTTGGCTGGGACACTCATGGCCTCCCAATCGAGCATGAGATCGATAAGAAGCTGGGCATATCTGGCAAGGCT
GCTGTTACCCAGTTTGGCATCGAGCAATACAATGCGGAGTGCAGGTCAATAGTCATGAGGTTTTCGCAGGAGTGG
CGAACAACGATCGAACGTCTTGGCCGTTGGATAGATTTTGACAACGATTACAAGGGTCTGCATGCTGACAGTTTT
CTTATCTGCAAGACCATGGACCCTAAATTTATGGAATCATTGTGGTGGGTATTCAAGCAGTTGTTCGACAAGGGC
CAAGTCTATCAGGGATATCGTGTTATGCCCTACTCGACAGTTCTCACAACTGCATTGAGCAACTTCGAAGCAAAC
CAGAATTACCAAGATGTCAACGATCCTGCTGTGGTCGTGTCCTTTCCCCTATTGGACTACTCGGACGTCCATCTC
CTGGCCTGGACTACAACCCCCTGGACTCTTCCCTCCCACACTGGCTTAGTTGTGAATCCGGAATTCGAATATGTC
AAAATATACGACAAGGAATCCTGCAAATTGTACATTTTACTGGAGAAATTGCTTGGGACTCTCTACAAGGACCCC
AAGAAAGCCAAGTTTACCATTGTGGACAAGCTTCGGGGTAAGCAGATGGTCGGCTGGCGATACAAGCCATTGTTT
GGTTACTTCTACGATGAGTTTAAAGATGTTGGGTTTCGGGTCTTCGGCGGTAACTACGTGACGGACGAGAGCGGT
ACTGGAATTGTTCACCAGGCCCCAGCATTTGGAGAAGATGACTACAATGTCGCTCTGCAGGCCGGAGTCATCAAC
GAGCAGCGACCCCCCCCTGATCCAGTTGACGACACAGGCCATTTCACTGACCGAGTCCCTGACTTTGCTGGCATG
CACGTCAAAGATGCGGACAAGCATATCATTAAGCATTTAAAGAACATTGACCGTTTAGTGATCGATTCACAGATC
AGACACTCGTACCCGATGTGCCCTCGATCTGATACGCCTCTCATTTACCGAGCTGTTCCTTCATGGTTCATTCGC
ATACCTGAAATCATTCCTGATATGCTAAAAAATATAGAGGGATCTCACTGGGTTCCGTCCTTTGTCAAAGAGCGT
CGTTTCGCCAGCTGGATTGCCAATGCCCGCGACTGGAACGTCGGGAGAAACCGCTATTGGGGTACGCCCATTCCT
CTCTGGGTCAGCGAAGACTTGGAGGAGCATGTCTGTGTCGGCAGCATCGAAGAATTGCGGGAATTAAGCGGCTAC
GAGGGAGATTTGACGGACATTCATCGCGACAAAATCGATCACATCACAATTCCCAGTACCAAAGGCAAAGGGAGT
CTGCGGCGAATTGACGAAGTGTTCGATTGCTGGTTTGAGTCTGGTAGCATGCCGTACGCCTGCCAGCACTACCCA
TTCGAGAACATTGACAGGTTCAATCAGTCGTTCCCAGGAGACTTTATCGCTGAGGGCCTAGACCAAACAAGAGGG
TGGTTTTACACGCTTCTCGTGCTAGGCACACATCTCTTTGGCTGTTCGCCCTTTCAAAATTGTGTTGTCAATGGC
ATTGTGCTTGCCGAAGATGGGAAGAAGATGTCAAAGCGATTGAAAAATTATCCGGATCCAATGTTGATAATGGAG
AAGTACGGTTCGGATGCTCTTCGCCTCTATCTCATCAACTCTCCCGTGGTCAGAGCAGAGCCTCTACGATTTAAA
GAAGCCGGTGTAAAAGAAGTTGTTCAGAAGGTCCTACTGCCTCTGTGGAATAGCTTCAAGTTCTTTCAAAACCAA
ACAGCCCTTCTGAAAAAGGTTCAAGGCTTTGATTACCAGTGGAGTCCCAAGAATGGAGTGCGAAACACGAATGTC
ATGGATCGATGGATTTTGGCAAGCTGCCAGAGTCTCCTGCAATTCGTGAACGAAGAGATGCGAGGCTATCGTCTA
TACACCGTTGTTCCCCGACTCCTTGAGCTCATCGATAACACCACGAATTGGTACATACGCTTCAACCGTCGAAGA
CTCAAGGGGGAAAATGGTCTTCAAGACACTTTGTGTGCCCTCGATGCTCTTTTCGAGGTCTTGTACACACTGTGC
AGAGGCCTAGCGCCTTTTACTCCATTTTTGGCGGACAATATTTACCTGAAGCTCCTTCCGCATATTCCGAATGAG
CTCCATGATTTTGATACTCGAAGCGTCCACTTTTTACCCTTTCCGGAAGTGCGGCAGGAACTTTTCGATGCTGAT
GTGGAGAGAAGGGTAGCAAGAATGCAGCGCGTCATCGAACTGGGTCGGGTTTCAAGAGAGAGGAGAGGCGTCAGT
CTCAAGACACCATTGAGGAGCTTAGTGGTGATCCATCATAATCAGCAATTCTTGGAGGACGTAGGCGAGCTAAAA
AGCTACGTCACGGAGGAGCTCAACCTCCGAGAACTTATATTGTCTGGGGATGAAGCCAATTACAATGTCCAATTC
AGCGTCACTGCTGACTGGCCAGTCTTGGGTAAGAAGCTCAGAAAAGACATGGCACGCGTTAAAAAGGGGCTTCCG
GGTCTGGCCAGCGAACAGGTCAAGCAATATCTTCGAGATAAGGAAATATGGGTGGATGGCATACGATTGGAGGAA
GGCGATCTCGTCGTTCGTCGGGGACTCGATGACAATTCTGCTTCGAAGTCATTAGAGATCAACTCGGACAACGAA
GTGCTGACAATTCTAGATGCCGCGATATATCCTGAACTGGCCCAAGAGGGTGTAGCTCGGGAGATAATCAACCGA
GTGCAACGCCTCCGCAAAAAGGCTGGTCTTCAGGCTACGGACGATGTCAGGATGGACTACCTGGTGCTGTCCGAT
CCGGATGGAGTGGGCCTATCATCGATACTGCCCTCCCATGCTGCTGCCTTTGAGAAGACTTTGCGGAGACCACTT
GAGCTATTCGACGACGGGGCTGGTGAGGGCGAAGTCATCGTCGAGGAAAAACAGGAGGTGCAACGGGCGACAATC
TTGCTTCGCCTTCTTCGGATATAA
Gene >Hirsu2|4010
ATGTCCGTCAATTTCCCCAAGGAAGAGGAGGCTACCATCGAGCGATGGCGAAACATAAAGGCTTTTCATCGTCAG
GTACGAATCAAGTAGCATATGTCTCCTTTCTGCTAACTCCTTGTTCCGATCAGCTTGAATTGTCTGCTGGCCGGC
CGCGGTACACGTTCTACGATGGACCACCGTTCGCAACTGGACTACCTCATTATGGTCATCTGCTGGCATCTACTA
TTAAAGATATCATACCACGTTATTGGTCTATGAAAGGCTATCACGTCGAGCGTCGCTTTGGCTGGGACACTCATG
GCCTCCCAATCGAGCATGAGATCGATAAGAAGCTGGGCATATCTGGCAAGGCTGCTGTTACCCAGTTTGGCATCG
AGCAATACAATGCGGAGTGCAGGTCAATAGTCATGAGGTTTTCGCAGGAGTGGCGAACAACGATCGAACGTCTTG
GCCGTTGGATAGATTTTGACAACGATTACAAGGTCAGCTCTCGCACTCTTCCAAGGCATTAGACGAGACGCCCTC
TCGCTCCTGGTCAGGGTCTGCATGCTGACAGTTTTCTTATCTGCAAGACCATGGACCCTAAATTTATGGAATCAT
TGTGGTGGGTATTCAAGCAGTTGTTCGACAAGGGCCAAGTCTATCAGGGATATCGTGTTATGCCCTACTCGACAG
TTCTCACAACTGCATTGAGCAACTTCGAAGCAAACCAGAATTACCAAGATGTCAACGATCCTGCTGTGGTCGTGT
CCTTTCCCCTATTGGACTACTCGGACGTCCATCTCCTGGCCTGGACTACAACCCCCTGGACTCTTCCCTCCCACA
CTGGCTTAGTTGTGAATCCGGAATTCGAATATGTCAAAATATACGACAAGGAATCCTGCAAATTGTACATTTTAC
TGGAGAAATTGCTTGGGACTCTCTACAAGGACCCCAAGAAAGCCAAGTTTACCATTGTGGACAAGCTTCGGGGTA
AGCAGATGGTCGGCTGGCGATACAAGCCATTGTTTGGTTACTTCTACGATGAGTTTAAAGATGTTGGGTTTCGGG
TCTTCGGCGGTAACTACGTGACGGACGAGAGCGGTACTGGAATTGTTCACCAGGCCCCAGCATTTGGAGAAGATG
ACTACAATGTCGCTCTGCAGGCCGGAGTCATCAACGAGCAGCGACCCCCCCCTGATCCAGTTGACGACACAGGCC
ATTTCACTGACCGAGTCCCTGACTTTGCTGGCATGCACGTCAAAGATGCGGACAAGCATATCATTAAGCATTTAA
AGAACATTGACCGTTTAGTGATCGATTCACAGATCAGACACTCGTACCCGATGTGCCCTCGATCTGATACGCCTC
TCATTTACCGAGCTGTTCCTTCATGGTTCATTCGCATACCTGAAATCATTCCTGATATGCTAAAAAATATAGAGG
GATCTCACTGGGTTCCGTCCTTTGTCAAAGAGCGTCGTTTCGCCAGCTGGATTGCCAATGCCCGCGACTGGAACG
TCGGGAGAAACCGCTATTGGGGTACGCCCATTCCTCTCTGGGTCAGCGAAGACTTGGAGGAGCATGTCTGTGTCG
GCAGCATCGAAGAATTGCGGGAATTAAGCGGCTACGAGGGAGATTTGACGGACATTCATCGCGACAAAATCGATC
ACATCACAATTCCCAGTACCAAAGGCAAAGGGAGTCTGCGGCGAATTGACGAAGTGTTCGATTGCTGGTTTGAGT
CTGGTAGCATGCCGTACGCCTGCCAGCACTACCCATTCGAGAACATTGACAGGTTCAATCAGTCGTTCCCAGGAG
ACTTTATCGCTGAGGGCCTAGACCAAACAAGAGGGTGGTTTTACACGCTTCTCGTGCTAGGCACACATCTCTTTG
GCTGTTCGCCCTTTCAAAATTGTGTTGTCAATGGCATTGTGCTTGCCGAAGATGGGAAGAAGATGTCAAAGCGAT
TGAAAAATTATCCGGATCCAATGTTGATAATGGAGAAGTACGGTTCGGATGCTCTTCGCCTCTATCTCATCAACT
CTCCCGTGGTCAGAGCAGAGCCTCTACGATTTAAAGAAGCCGGTGTAAAAGAAGTTGTTCAGAAGGTCCTACTGC
CTCTGTGGAATAGCTTCAAGTTCTTTCAAAACCAAACAGCCCTTCTGAAAAAGGTTCAAGGCTTTGATTACCAGT
GGAGTCCCAAGAATGGAGTGCGAAACACGAATGTCATGGATCGATGGATTTTGGCAAGCTGCCAGAGTCTCCTGC
AATTCGTGAACGAAGAGATGCGAGGTGAGAGTTTGCAATCCGACAAATCAAACCGAGCAAATTTTAATAGGAAAA
AATAGGCTATCGTCTATACACCGTTGTTCCCCGACTCCTTGAGCTCATCGATAACACCACGAATTGGTACATACG
CTTCAACCGTCGAAGACTCAAGGGGGAAAATGGTCTTCAAGACACTTTGTGTGCCCTCGATGCTCTTTTCGAGGT
CTTGTACACACTGTGCAGAGGCCTAGCGCCTTTTACTCCATTTTTGGCGGACAATATTTACCTGAAGCTCCTTCC
GCATATTCCGAATGAGCTCCATGATTTTGATACTCGAAGCGTCCACTTTTTACCCTTTCCGGAAGTGCGGCAGGA
ACTTTTCGATGCTGATGTGGAGAGAAGGGTAGCAAGAATGCAGCGCGTCATCGAACTGGGTCGGGTTTCAAGAGA
GAGGAGAGGCGTCAGTCTCAAGACACCATTGAGGAGCTTAGTGGTGATCCATCATAATCAGCAATTCTTGGAGGA
CGTAGGCGAGCTAAAAAGCTACGTCACGGAGGAGCTCAACCTCCGAGAACTTATATTGTCTGGGGATGAAGCCAA
TTACAATGTCCAATTCAGCGTCACTGCTGACTGGCCAGTCTTGGGTAAGAAGCTCAGAAAAGACATGGCACGCGT
TAAAAAGGGGCTTCCGGGTCTGGCCAGCGAACAGGTCAAGCAATATCTTCGAGATAAGGAAATATGGGTGGATGG
CATACGATTGGAGGAAGGCGATCTCGTCGTTCGTCGGGGACTCGATGACAATTCTGCTTCGAAGTCATTAGAGAT
CAACTCGGACAACGAAGTGCTGACAATTCTAGATGCCGCGATATATCCTGAACTGGCCCAAGAGGGTGTAGCTCG
GGAGATAATCAACCGAGTGCAACGCCTCCGCAAAAAGGCTGGTCTTCAGGCTACGGACGATGTCAGGATGGACTA
CCTGGTGCTGTCCGATCCGGATGGAGTGGGCCTATCATCGATACTGCCCTCCCATGCTGCTGCCTTTGAGAAGAC
TTTGCGGAGACCACTTGAGCTATTCGACGACGGGGCTGGTGAGGGCGAAGTCATCGTCGAGGAAAAACAGGAGGT
GCAACGGGCGACAATCTTGCTTCGCCTTCTTCGGATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail