Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4007
Gene name
LocationContig_209:25533..27616
Strand-
Gene length (bp)2083
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.4E-59 21 274
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.4E-31 22 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 10 356 6.0E-83
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 7 317 7.0E-80
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 2 317 1.0E-79
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 7 317 3.0E-78
sp|Q9JJX8|ST32B_MOUSE Serine/threonine-protein kinase 32B OS=Mus musculus GN=Stk32b PE=2 SV=2 2 323 7.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 10 356 6.0E-83
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 7 317 7.0E-80
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 2 317 1.0E-79
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 7 317 3.0E-78
sp|Q9JJX8|ST32B_MOUSE Serine/threonine-protein kinase 32B OS=Mus musculus GN=Stk32b PE=2 SV=2 2 323 7.0E-78
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 2 323 9.0E-77
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 2 302 4.0E-64
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 3 306 2.0E-62
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 5 306 1.0E-60
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 13 324 4.0E-60
sp|O74426|PPK33_SCHPO Serine/threonine-protein kinase ppk33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk33 PE=3 SV=1 1 308 3.0E-59
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 20 319 1.0E-57
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 3 305 4.0E-57
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 6 305 7.0E-57
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 17 312 1.0E-56
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 13 312 1.0E-56
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 15 312 1.0E-56
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 14 294 2.0E-56
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 15 305 3.0E-56
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 15 305 4.0E-56
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 3 312 5.0E-56
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 14 295 7.0E-56
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 2 308 8.0E-56
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 15 312 1.0E-55
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 15 312 1.0E-55
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 2 308 1.0E-55
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 6 317 2.0E-55
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 15 305 3.0E-55
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 2 312 4.0E-55
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 2 308 8.0E-55
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 2 308 8.0E-55
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 6 305 9.0E-55
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 6 317 2.0E-54
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 5 312 2.0E-54
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 19 308 2.0E-54
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 2 312 3.0E-54
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 2 312 4.0E-54
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 15 312 5.0E-54
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 13 294 5.0E-54
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 15 305 6.0E-54
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 13 294 6.0E-54
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 14 297 7.0E-54
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 20 308 9.0E-54
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 12 312 9.0E-54
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 12 312 9.0E-54
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 12 312 1.0E-53
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 12 312 1.0E-53
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 16 358 1.0E-53
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 20 308 1.0E-53
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 14 308 1.0E-53
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 13 294 2.0E-53
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 6 312 2.0E-53
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 20 305 4.0E-53
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 14 312 7.0E-53
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 2 305 7.0E-53
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 2 308 8.0E-53
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 20 305 9.0E-53
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 12 295 1.0E-52
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 18 308 2.0E-52
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 2 308 2.0E-52
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 2 308 2.0E-52
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 2 308 2.0E-52
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 2 308 3.0E-52
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 2 308 3.0E-52
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 4 298 3.0E-52
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 18 308 4.0E-52
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 13 295 4.0E-52
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 2 308 5.0E-52
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 18 298 5.0E-52
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 2 305 6.0E-52
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 20 305 7.0E-52
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 9 312 8.0E-52
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 9 312 9.0E-52
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 15 308 1.0E-51
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 9 312 1.0E-51
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 2 310 1.0E-51
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 2 308 1.0E-51
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 19 308 1.0E-51
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 2 308 1.0E-51
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 9 294 1.0E-51
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 10 308 2.0E-51
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 18 308 3.0E-51
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 15 305 4.0E-51
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 15 305 5.0E-51
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 5 312 5.0E-51
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 15 305 6.0E-51
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 18 305 7.0E-51
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 18 294 1.0E-50
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 20 305 1.0E-50
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 19 308 1.0E-50
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 18 305 1.0E-50
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 15 305 1.0E-50
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 15 305 1.0E-50
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 15 305 1.0E-50
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 11 323 1.0E-50
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 15 305 1.0E-50
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 7 305 2.0E-50
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 15 305 2.0E-50
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 20 308 2.0E-50
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 7 305 2.0E-50
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 7 305 3.0E-50
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 7 305 3.0E-50
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 18 308 3.0E-50
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 15 305 3.0E-50
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 15 305 3.0E-50
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 15 305 3.0E-50
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 11 305 6.0E-50
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 15 305 9.0E-50
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 20 308 1.0E-49
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 14 305 1.0E-49
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 15 305 1.0E-49
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 7 301 2.0E-49
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 20 305 2.0E-49
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 11 305 2.0E-49
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 18 294 2.0E-49
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 14 305 3.0E-49
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 7 301 4.0E-49
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 20 305 5.0E-49
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 20 305 5.0E-49
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 20 305 5.0E-49
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 20 305 6.0E-49
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 7 305 6.0E-49
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 15 309 6.0E-49
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 20 305 7.0E-49
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 10 301 8.0E-49
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 7 301 8.0E-49
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 10 236 8.0E-49
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 20 305 9.0E-49
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 20 309 1.0E-48
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 8 305 1.0E-48
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 15 305 2.0E-48
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 20 305 2.0E-48
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 18 310 3.0E-48
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 16 305 6.0E-48
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 2 305 6.0E-48
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 15 305 6.0E-48
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 16 305 7.0E-48
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 16 305 1.0E-47
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 13 305 1.0E-47
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 16 310 1.0E-47
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 17 310 2.0E-47
sp|Q16513|PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens GN=PKN2 PE=1 SV=1 14 332 3.0E-47
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 13 305 4.0E-47
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 2 305 4.0E-47
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 13 305 5.0E-47
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 13 305 5.0E-47
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 13 305 5.0E-47
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 20 309 5.0E-47
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 15 308 6.0E-47
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 17 310 7.0E-47
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 15 216 7.0E-47
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 16 310 7.0E-47
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 20 302 7.0E-47
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 12 236 1.0E-46
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 16 310 1.0E-46
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 2 305 1.0E-46
sp|Q62833|GRK5_RAT G protein-coupled receptor kinase 5 OS=Rattus norvegicus GN=Grk5 PE=2 SV=1 15 310 1.0E-46
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 15 302 1.0E-46
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 20 295 2.0E-46
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 18 308 2.0E-46
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 7 307 2.0E-46
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 15 310 2.0E-46
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 15 297 3.0E-46
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 15 309 3.0E-46
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 17 310 3.0E-46
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 15 302 5.0E-46
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 14 294 5.0E-46
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 13 236 7.0E-46
sp|O08874|PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus GN=Pkn2 PE=1 SV=2 14 358 7.0E-46
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 16 310 7.0E-46
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 12 306 8.0E-46
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 16 310 8.0E-46
sp|Q10364|SCK2_SCHPO Serine/threonine-protein kinase sck2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck2 PE=3 SV=1 20 305 9.0E-46
sp|A1Z7T0|PKN_DROME Serine/threonine-protein kinase N OS=Drosophila melanogaster GN=Pkn PE=1 SV=1 6 312 1.0E-45
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 15 310 1.0E-45
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 12 322 1.0E-45
sp|Q8VEB1|GRK5_MOUSE G protein-coupled receptor kinase 5 OS=Mus musculus GN=Grk5 PE=1 SV=2 15 310 1.0E-45
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 14 319 2.0E-45
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 13 305 2.0E-45
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 15 317 2.0E-45
sp|Q8BWW9|PKN2_MOUSE Serine/threonine-protein kinase N2 OS=Mus musculus GN=Pkn2 PE=1 SV=3 14 342 2.0E-45
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus GN=Pkn1 PE=1 SV=2 15 362 2.0E-45
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 8 305 2.0E-45
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus GN=Pkn1 PE=1 SV=3 15 362 4.0E-45
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 17 309 7.0E-45
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 17 309 9.0E-45
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 16 303 1.0E-44
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 15 317 1.0E-44
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 17 309 1.0E-44
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 17 310 1.0E-44
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 17 310 1.0E-44
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 17 310 1.0E-44
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pneumocystis carinii GN=CBK1 PE=2 SV=1 14 230 2.0E-44
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 14 294 2.0E-44
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 18 306 2.0E-44
sp|A7MBL8|PKN2_DANRE Serine/threonine-protein kinase N2 OS=Danio rerio GN=pkn2 PE=2 SV=1 14 312 3.0E-44
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 10 294 3.0E-44
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 17 236 3.0E-44
sp|A1A4I4|PKN1_BOVIN Serine/threonine-protein kinase N1 OS=Bos taurus GN=PKN1 PE=2 SV=1 15 305 5.0E-44
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 15 302 6.0E-44
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 15 302 7.0E-44
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 10 294 7.0E-44
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 14 294 8.0E-44
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 17 316 8.0E-44
sp|P32298|GRK4_HUMAN G protein-coupled receptor kinase 4 OS=Homo sapiens GN=GRK4 PE=1 SV=3 15 310 9.0E-44
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 15 302 1.0E-43
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 15 302 1.0E-43
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 15 302 1.0E-43
sp|Q16512|PKN1_HUMAN Serine/threonine-protein kinase N1 OS=Homo sapiens GN=PKN1 PE=1 SV=2 15 305 1.0E-43
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 7 296 2.0E-43
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 7 283 2.0E-43
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 17 264 4.0E-43
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 5 324 4.0E-43
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 15 230 4.0E-43
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 14 294 5.0E-43
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 20 302 5.0E-43
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 17 236 5.0E-43
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 17 264 7.0E-43
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 20 302 7.0E-43
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 20 302 1.0E-42
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 16 310 2.0E-42
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 17 264 2.0E-42
sp|P32866|GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster GN=Gprk2 PE=1 SV=3 20 310 2.0E-42
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 18 306 2.0E-42
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 20 310 4.0E-42
sp|Q5AP53|CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBK1 PE=1 SV=1 17 237 4.0E-42
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 12 264 7.0E-42
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 12 264 7.0E-42
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 16 309 7.0E-42
sp|B6CZ17|GRK7A_XENLA G protein-coupled receptor kinase 7A OS=Xenopus laevis GN=grk7-a PE=1 SV=1 15 294 8.0E-42
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 16 236 9.0E-42
sp|P38679|COT1_NEUCR Serine/threonine-protein kinase cot-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-1 PE=2 SV=2 19 301 1.0E-41
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 15 301 2.0E-41
sp|B6CZ18|GRK7B_XENLA G protein-coupled receptor kinase 7B OS=Xenopus laevis GN=grk7-b PE=1 SV=1 15 294 2.0E-41
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 20 306 2.0E-41
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 20 306 2.0E-41
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 11 305 2.0E-41
sp|Q8WP15|GRK7_PIG G protein-coupled receptor kinase 7 OS=Sus scrofa GN=GRK7 PE=1 SV=1 15 294 3.0E-41
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens GN=PKN3 PE=1 SV=1 17 295 3.0E-41
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 5 307 3.0E-41
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 20 306 4.0E-41
sp|P43250|GRK6_HUMAN G protein-coupled receptor kinase 6 OS=Homo sapiens GN=GRK6 PE=1 SV=2 15 310 5.0E-41
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 20 302 6.0E-41
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos taurus GN=GRK7 PE=1 SV=1 15 294 1.0E-40
sp|Q9Z2G7|GRK7_ICTTR G protein-coupled receptor kinase 7 OS=Ictidomys tridecemlineatus GN=GRK7 PE=1 SV=1 15 294 1.0E-40
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 20 275 2.0E-40
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 12 283 2.0E-40
sp|Q8WTQ7|GRK7_HUMAN G protein-coupled receptor kinase 7 OS=Homo sapiens GN=GRK7 PE=1 SV=1 15 294 5.0E-40
sp|Q49HM9|GRK7A_DANRE G-protein-coupled receptor kinase 7A OS=Danio rerio GN=grk7a PE=1 SV=2 15 310 7.0E-40
sp|O70293|GRK6_MOUSE G protein-coupled receptor kinase 6 OS=Mus musculus GN=Grk6 PE=1 SV=1 15 310 8.0E-40
sp|O70291|GRK4_MOUSE G protein-coupled receptor kinase 4 OS=Mus musculus GN=Grk4 PE=2 SV=2 15 294 8.0E-40
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 23 236 8.0E-40
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 20 309 1.0E-39
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 14 220 2.0E-39
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 14 220 2.0E-39
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 20 309 2.0E-39
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 20 309 2.0E-39
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 20 309 2.0E-39
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 13 301 2.0E-39
sp|P70507|GRK4_RAT G protein-coupled receptor kinase 4 OS=Rattus norvegicus GN=Grk4 PE=1 SV=1 15 294 2.0E-39
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 18 306 2.0E-39
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 5 307 3.0E-39
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 20 307 3.0E-39
sp|Q99MK8|ARBK1_MOUSE Beta-adrenergic receptor kinase 1 OS=Mus musculus GN=Adrbk1 PE=1 SV=2 5 307 3.0E-39
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 16 236 4.0E-39
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 20 307 4.0E-39
sp|P97711|GRK6_RAT G protein-coupled receptor kinase 6 OS=Rattus norvegicus GN=Grk6 PE=2 SV=1 15 310 5.0E-39
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 14 305 5.0E-39
sp|P32865|GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster GN=Gprk1 PE=2 SV=2 5 307 6.0E-39
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 5 307 6.0E-39
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 5 307 7.0E-39
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 15 303 7.0E-39
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 15 303 7.0E-39
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 15 303 7.0E-39
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 16 302 8.0E-39
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 15 303 9.0E-39
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 18 320 9.0E-39
sp|P21146|ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus GN=ADRBK1 PE=1 SV=1 5 307 9.0E-39
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 6 307 1.0E-38
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 20 228 3.0E-38
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 20 216 4.0E-38
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 20 320 4.0E-38
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 18 296 4.0E-38
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 20 320 4.0E-38
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 20 277 4.0E-38
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 20 236 4.0E-38
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 5 307 7.0E-38
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 18 306 8.0E-38
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 20 236 9.0E-38
sp|Q09537|GRK1_CAEEL G protein-coupled receptor kinase 1 OS=Caenorhabditis elegans GN=grk-1 PE=3 SV=1 15 216 1.0E-37
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 17 308 1.0E-37
sp|Q64682|ARBK1_MESAU Beta-adrenergic receptor kinase 1 OS=Mesocricetus auratus GN=ADRBK1 PE=2 SV=1 5 307 1.0E-37
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 17 295 1.0E-37
sp|P28327|RK_BOVIN Rhodopsin kinase OS=Bos taurus GN=GRK1 PE=1 SV=1 18 296 1.0E-37
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 20 236 1.0E-37
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 18 306 1.0E-37
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 13 216 2.0E-37
sp|Q1XHL7|GRK7B_DANRE G protein-coupled receptor kinase 7B OS=Danio rerio GN=grk7b PE=1 SV=2 19 310 2.0E-37
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 17 277 3.0E-37
sp|Q622Z7|GRK1_CAEBR G protein-coupled receptor kinase 1 OS=Caenorhabditis briggsae GN=grk-1 PE=3 SV=1 15 216 3.0E-37
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 14 262 4.0E-37
sp|P35626|ARBK2_HUMAN Beta-adrenergic receptor kinase 2 OS=Homo sapiens GN=ADRBK2 PE=1 SV=2 5 307 5.0E-37
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 13 216 8.0E-37
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 15 295 8.0E-37
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 20 216 8.0E-37
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 20 216 1.0E-36
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 20 216 1.0E-36
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 20 216 1.0E-36
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 17 219 2.0E-36
sp|P26819|ARBK2_RAT Beta-adrenergic receptor kinase 2 OS=Rattus norvegicus GN=Adrbk2 PE=2 SV=1 5 216 2.0E-36
sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus GN=Adrbk2 PE=1 SV=2 5 216 2.0E-36
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 20 302 2.0E-36
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 8 334 2.0E-36
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 13 302 2.0E-36
sp|Q9WVL4|RK_MOUSE Rhodopsin kinase OS=Mus musculus GN=Grk1 PE=1 SV=1 18 296 2.0E-36
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 20 303 3.0E-36
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 20 302 4.0E-36
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 15 302 4.0E-36
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 17 281 5.0E-36
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 15 262 5.0E-36
sp|Q63651|RK_RAT Rhodopsin kinase OS=Rattus norvegicus GN=Grk1 PE=1 SV=1 15 296 7.0E-36
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 14 262 8.0E-36
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 5 277 9.0E-36
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 17 227 1.0E-35
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 17 262 1.0E-35
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 18 216 1.0E-35
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 13 303 1.0E-35
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 17 262 1.0E-35
sp|O64682|PID_ARATH Protein kinase PINOID OS=Arabidopsis thaliana GN=PID PE=1 SV=1 15 296 1.0E-35
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 20 280 2.0E-35
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 20 306 2.0E-35
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 24 277 2.0E-35
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBK1 PE=3 SV=1 20 165 2.0E-35
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 20 301 2.0E-35
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 20 301 3.0E-35
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 16 237 3.0E-35
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 16 261 3.0E-35
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 16 261 3.0E-35
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 20 283 3.0E-35
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBK1 PE=3 SV=1 20 165 4.0E-35
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 16 289 4.0E-35
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 15 305 4.0E-35
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBK1 PE=1 SV=1 20 165 4.0E-35
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 17 277 4.0E-35
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 16 236 8.0E-35
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 20 306 9.0E-35
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 14 165 1.0E-34
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 1 273 1.0E-34
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 16 261 1.0E-34
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 1 273 1.0E-34
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 20 301 1.0E-34
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 20 302 2.0E-34
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 14 292 2.0E-34
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 20 277 2.0E-34
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 20 301 2.0E-34
sp|P16911|KDC1_DROME Protein kinase DC1 OS=Drosophila melanogaster GN=Pka-C2 PE=2 SV=1 16 220 2.0E-34
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 16 289 2.0E-34
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 20 306 2.0E-34
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 14 292 2.0E-34
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 9 277 2.0E-34
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 20 277 3.0E-34
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 20 220 3.0E-34
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBK1 PE=3 SV=2 20 165 3.0E-34
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 12 262 4.0E-34
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 1 274 4.0E-34
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 16 289 5.0E-34
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 9 285 5.0E-34
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 14 293 5.0E-34
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 16 262 6.0E-34
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 16 289 6.0E-34
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 16 289 6.0E-34
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 17 277 7.0E-34
sp|Q9LUL2|WAG2_ARATH Serine/threonine-protein kinase WAG2 OS=Arabidopsis thaliana GN=WAG2 PE=2 SV=1 13 231 1.0E-33
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 1 273 1.0E-33
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 24 262 1.0E-33
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 20 305 1.0E-33
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 18 228 1.0E-33
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 13 277 2.0E-33
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 17 275 2.0E-33
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 15 265 2.0E-33
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 20 289 2.0E-33
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 2 275 3.0E-33
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 3 262 3.0E-33
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 24 314 3.0E-33
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 20 276 3.0E-33
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 20 230 3.0E-33
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 17 277 4.0E-33
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 2 275 4.0E-33
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 24 266 4.0E-33
sp|O62846|KAPCG_MACMU cAMP-dependent protein kinase catalytic subunit gamma (Fragment) OS=Macaca mulatta GN=PRKACG PE=2 SV=3 18 187 4.0E-33
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 13 236 6.0E-33
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 16 240 6.0E-33
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 19 236 6.0E-33
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 13 266 6.0E-33
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 20 262 7.0E-33
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 13 266 7.0E-33
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 17 262 8.0E-33
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 8 223 1.0E-32
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 15 277 1.0E-32
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 3 262 1.0E-32
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 16 289 2.0E-32
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 15 262 2.0E-32
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 15 236 2.0E-32
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 17 218 2.0E-32
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 16 289 2.0E-32
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 17 219 2.0E-32
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 15 262 3.0E-32
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 26 236 3.0E-32
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 24 302 3.0E-32
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 17 219 3.0E-32
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 16 262 4.0E-32
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 25 241 4.0E-32
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 15 240 4.0E-32
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 17 241 5.0E-32
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 13 236 5.0E-32
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 25 228 5.0E-32
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 17 282 5.0E-32
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 17 381 6.0E-32
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 17 282 6.0E-32
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 20 326 9.0E-32
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 16 240 9.0E-32
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 17 281 1.0E-31
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 16 218 1.0E-31
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 1 262 1.0E-31
sp|Q6CFS5|CBK1_YARLI Serine/threonine-protein kinase CBK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBK1 PE=3 SV=1 17 165 1.0E-31
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 16 262 1.0E-31
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 16 240 2.0E-31
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 6 262 2.0E-31
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 13 279 2.0E-31
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 17 280 2.0E-31
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 16 228 2.0E-31
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 18 216 2.0E-31
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 18 216 2.0E-31
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 17 314 2.0E-31
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 17 281 2.0E-31
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 17 274 2.0E-31
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 17 265 3.0E-31
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 19 240 3.0E-31
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 19 240 3.0E-31
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 20 262 3.0E-31
sp|Q8MYQ1|Y31E_CAEEL Putative serine/threonine-protein kinase F31E3.2 OS=Caenorhabditis elegans GN=F31E3.2 PE=3 SV=1 15 290 4.0E-31
sp|Q9LTW5|AGC15_ARATH Serine/threonine-protein kinase AGC1-5 OS=Arabidopsis thaliana GN=AGC1-5 PE=1 SV=1 14 265 4.0E-31
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 20 277 4.0E-31
sp|Q9C8M5|WAG1_ARATH Serine/threonine-protein kinase WAG1 OS=Arabidopsis thaliana GN=WAG1 PE=2 SV=1 13 264 5.0E-31
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 18 216 5.0E-31
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 26 285 5.0E-31
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 3 236 6.0E-31
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 15 262 6.0E-31
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 24 230 8.0E-31
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 17 262 1.0E-30
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 20 261 1.0E-30
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 26 263 1.0E-30
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 25 304 1.0E-30
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 17 277 1.0E-30
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 18 216 1.0E-30
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 16 218 1.0E-30
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 19 228 1.0E-30
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 8 262 1.0E-30
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 19 228 2.0E-30
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 2 262 2.0E-30
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 6 236 2.0E-30
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 2 262 2.0E-30
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 19 240 2.0E-30
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 15 241 2.0E-30
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 26 277 2.0E-30
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 20 262 2.0E-30
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 25 304 3.0E-30
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 25 304 3.0E-30
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 17 280 3.0E-30
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 20 262 3.0E-30
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 20 262 3.0E-30
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 18 275 4.0E-30
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 11 276 6.0E-30
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 17 265 6.0E-30
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 26 262 6.0E-30
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 20 261 6.0E-30
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 20 261 7.0E-30
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 25 224 8.0E-30
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 12 236 8.0E-30
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 14 236 1.0E-29
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 24 262 1.0E-29
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 20 216 1.0E-29
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 18 262 1.0E-29
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 17 281 1.0E-29
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 9 262 1.0E-29
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 15 266 1.0E-29
sp|Q9VWQ2|S6KL_DROME Serine/threonine-protein kinase S6KL OS=Drosophila melanogaster GN=S6KL PE=1 SV=1 20 215 2.0E-29
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 9 262 2.0E-29
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 20 229 2.0E-29
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 2 262 2.0E-29
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 18 228 2.0E-29
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 20 229 2.0E-29
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 18 286 2.0E-29
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 17 237 2.0E-29
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 9 262 2.0E-29
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 23 261 3.0E-29
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 18 287 3.0E-29
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 20 265 4.0E-29
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 24 262 4.0E-29
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 20 229 4.0E-29
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 25 216 1.0E-25
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 26 216 8.0E-25
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 26 216 8.0E-25
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 25 216 1.0E-24
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 20 216 1.0E-24
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 25 216 2.0E-24
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 26 216 3.0E-24
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 13 216 3.0E-24
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 26 223 9.0E-23
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 26 223 2.0E-22
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 20 238 1.0E-21
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 26 216 2.0E-21
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 26 222 2.0E-21
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 26 222 3.0E-21
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 26 222 4.0E-20
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 26 216 1.0E-19
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 20 262 4.0E-19
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 25 218 2.0E-18
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 26 220 6.0E-18
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 26 220 9.0E-18
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 92 222 2.0E-15
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 29 216 7.0E-09
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBK1 PE=1 SV=1 175 357 4.0E-08
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBK1 PE=3 SV=1 175 357 5.0E-08
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBK1 PE=3 SV=1 146 357 2.0E-07
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBK1 PE=3 SV=2 146 357 2.0E-07
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 175 325 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4007
MGNGQGKPVDLTGEVNLNHFRLLRVVGRGAFGKVRIVERKDTNLSFALKYIRKDEVVKSESVRNIIRERRMLEHV
NHPFICNLRYSFQDIEYMYLVVDLMSGGDLRFHISRKTFTEEAVRFWIAELGCALQYVHGQGIIHRDVKPDNVLL
DADGHVHLTDFNVASDIIPGRVLTSKSGTLAYLAPEVYAGKGYDVRADWWSLGVLFYECIYNKRPFEGSNEATLS
QQIQNSSPKYPVTQPPVSLTCLYAIRAALDPNPKTRLGSTWESFIHNDFFREFDFDLLEQKRIEPIFVPSSDKTN
FDATYDLEELLLEEAPLEARARRQKPRERLKEDATQQEIREDELYRMIEKDFRPFDYTLAAYQKITEATQTLGED
GQLVVAPGDVPQALTTDEATPAPQRSKSTHAVKHPMVNRAHSVEKRPGRPSRPAAPAPQYQSQYVSRPSAPSKNR
VASPSGGVQVTLDGGGSWSELARQDATLPADASTMADPKAEGSGGMFGFLKSKRSRNNSPKPRERGVLGKEGARV
VIS*
Coding >Hirsu2|4007
ATGGGCAACGGTCAGGGAAAGCCCGTCGACCTCACCGGCGAAGTGAACCTCAACCACTTCCGCCTCTTGAGAGTC
GTCGGCCGCGGTGCCTTTGGCAAAGTACGCATCGTCGAACGCAAGGATACCAATCTGTCCTTTGCCCTCAAATAC
ATCCGCAAAGACGAAGTTGTCAAGTCCGAGAGCGTCCGGAACATCATACGCGAGCGGCGCATGCTCGAGCATGTC
AACCACCCCTTCATTTGCAACTTGCGCTACAGCTTCCAGGACATCGAATACATGTATCTCGTCGTCGATCTGATG
AGCGGCGGCGATCTCCGCTTTCACATCTCCAGGAAGACGTTTACCGAGGAGGCGGTACGATTTTGGATCGCCGAG
CTGGGCTGTGCCTTGCAATACGTTCACGGCCAGGGCATCATTCACCGGGATGTGAAACCGGACAACGTCCTCCTC
GATGCCGATGGACACGTCCACTTGACAGACTTTAACGTCGCCTCCGACATCATACCCGGAAGAGTGCTCACGAGC
AAGTCGGGGACCTTGGCCTATCTGGCCCCAGAGGTGTACGCCGGCAAGGGCTACGACGTTCGCGCGGACTGGTGG
TCTCTGGGTGTGCTGTTCTACGAGTGCATTTACAACAAGCGGCCCTTTGAGGGGAGCAATGAAGCCACTCTCAGC
CAACAGATCCAAAACAGCAGCCCGAAATATCCCGTCACGCAGCCTCCCGTCTCGCTCACCTGTCTCTACGCCATC
CGCGCCGCCCTGGATCCCAATCCCAAGACACGTCTCGGCTCTACGTGGGAGAGCTTCATCCACAACGACTTCTTT
CGCGAATTCGACTTTGACCTGCTGGAGCAGAAGCGGATAGAGCCCATCTTCGTGCCGTCCTCGGACAAGACCAAC
TTTGACGCCACGTACGATCTGGAGGAGCTGCTCCTCGAGGAGGCACCGCTCGAGGCTCGGGCCAGACGGCAGAAG
CCGCGGGAGCGGTTAAAAGAGGACGCGACGCAGCAGGAAATCCGCGAGGACGAGCTGTACAGGATGATCGAAAAG
GACTTTCGACCGTTCGACTACACGCTGGCTGCGTACCAAAAGATCACGGAGGCGACGCAAACCTTGGGCGAGGAC
GGCCAGCTTGTCGTGGCGCCGGGCGACGTGCCGCAGGCCCTCACGACGGACGAAGCGACGCCGGCCCCGCAGCGG
TCCAAGTCGACACACGCCGTCAAGCACCCAATGGTCAACCGCGCCCACAGTGTGGAGAAGCGGCCGGGTCGCCCG
TCGCGGCCCGCGGCGCCCGCGCCCCAGTACCAGAGCCAGTACGTCTCTCGGCCCTCGGCGCCGAGCAAGAACCGG
GTGGCGAGCCCCTCCGGGGGCGTGCAGGTGACGCTGGACGGAGGCGGCAGCTGGTCGGAGCTGGCGCGCCAGGAC
GCGACGCTGCCGGCCGACGCGAGCACCATGGCCGACCCCAAGGCCGAGGGCTCGGGAGGCATGTTCGGCTTCCTG
AAGAGCAAGCGAAGCCGGAACAACAGCCCGAAGCCGCGCGAGAGGGGCGTCCTCGGCAAGGAGGGCGCGCGGGTC
GTCATCAGCTAG
Transcript >Hirsu2|4007
ATGGGCAACGGTCAGGGAAAGCCCGTCGACCTCACCGGCGAAGTGAACCTCAACCACTTCCGCCTCTTGAGAGTC
GTCGGCCGCGGTGCCTTTGGCAAAGTACGCATCGTCGAACGCAAGGATACCAATCTGTCCTTTGCCCTCAAATAC
ATCCGCAAAGACGAAGTTGTCAAGTCCGAGAGCGTCCGGAACATCATACGCGAGCGGCGCATGCTCGAGCATGTC
AACCACCCCTTCATTTGCAACTTGCGCTACAGCTTCCAGGACATCGAATACATGTATCTCGTCGTCGATCTGATG
AGCGGCGGCGATCTCCGCTTTCACATCTCCAGGAAGACGTTTACCGAGGAGGCGGTACGATTTTGGATCGCCGAG
CTGGGCTGTGCCTTGCAATACGTTCACGGCCAGGGCATCATTCACCGGGATGTGAAACCGGACAACGTCCTCCTC
GATGCCGATGGACACGTCCACTTGACAGACTTTAACGTCGCCTCCGACATCATACCCGGAAGAGTGCTCACGAGC
AAGTCGGGGACCTTGGCCTATCTGGCCCCAGAGGTGTACGCCGGCAAGGGCTACGACGTTCGCGCGGACTGGTGG
TCTCTGGGTGTGCTGTTCTACGAGTGCATTTACAACAAGCGGCCCTTTGAGGGGAGCAATGAAGCCACTCTCAGC
CAACAGATCCAAAACAGCAGCCCGAAATATCCCGTCACGCAGCCTCCCGTCTCGCTCACCTGTCTCTACGCCATC
CGCGCCGCCCTGGATCCCAATCCCAAGACACGTCTCGGCTCTACGTGGGAGAGCTTCATCCACAACGACTTCTTT
CGCGAATTCGACTTTGACCTGCTGGAGCAGAAGCGGATAGAGCCCATCTTCGTGCCGTCCTCGGACAAGACCAAC
TTTGACGCCACGTACGATCTGGAGGAGCTGCTCCTCGAGGAGGCACCGCTCGAGGCTCGGGCCAGACGGCAGAAG
CCGCGGGAGCGGTTAAAAGAGGACGCGACGCAGCAGGAAATCCGCGAGGACGAGCTGTACAGGATGATCGAAAAG
GACTTTCGACCGTTCGACTACACGCTGGCTGCGTACCAAAAGATCACGGAGGCGACGCAAACCTTGGGCGAGGAC
GGCCAGCTTGTCGTGGCGCCGGGCGACGTGCCGCAGGCCCTCACGACGGACGAAGCGACGCCGGCCCCGCAGCGG
TCCAAGTCGACACACGCCGTCAAGCACCCAATGGTCAACCGCGCCCACAGTGTGGAGAAGCGGCCGGGTCGCCCG
TCGCGGCCCGCGGCGCCCGCGCCCCAGTACCAGAGCCAGTACGTCTCTCGGCCCTCGGCGCCGAGCAAGAACCGG
GTGGCGAGCCCCTCCGGGGGCGTGCAGGTGACGCTGGACGGAGGCGGCAGCTGGTCGGAGCTGGCGCGCCAGGAC
GCGACGCTGCCGGCCGACGCGAGCACCATGGCCGACCCCAAGGCCGAGGGCTCGGGAGGCATGTTCGGCTTCCTG
AAGAGCAAGCGAAGCCGGAACAACAGCCCGAAGCCGCGCGAGAGGGGCGTCCTCGGCAAGGAGGGCGCGCGGGTC
GTCATCAGCTAG
Gene >Hirsu2|4007
ATGGGCAACGGTCAGGGAAAGCCCGTCGACCTCACCGGCGAAGGTGCATTTGCCTTCCATTCCGCCTGTCGGCCA
ACATGGGCCCTGTTGACGCCCGCGCAGTGAACCTCAACCACTTCCGCCTCTTGAGAGTCGTCGGCCGCGGTGCCT
TTGGCAAAGTACGCATCGTCGAACGCAAGGATACCAATCTGTCCTTTGCCCTCAAATACATCCGCAAAGACGAAG
GTACGCGCACCCTTCGCCACTTGTCCCGCGCGATCCCCCCGGCCCCCGCTCGCGAGCTCTACTCGAGGCGACCCG
GTCGCGCCTCGGCCATGAGGAAACCTCCCGTCACAAGTGGCTGATATCGGGATGGGCTATAGTTGTCAAGTCCGA
GAGCGTCCGGAACATCATACGCGAGCGGCGCATGCTCGAGCATGTCAACCACCCCTTCATTTGCAACTTGCGCTA
CAGCTTCCAGGACATCGAATACATGTAGGCGCACCTGTCCCCTGCTGAAAGCCTCCCTGCTGCTGCCTCTGTCGT
CGACTCATCCTCGCCTGCCAGGTATCTCGTCGTCGATCTGATGAGCGGCGGCGATCTCCGCTTTCACATCTCCAG
GAAGACGTTTACCGAGGAGGCGGTACGATTTTGGATCGCCGAGCTGGGCTGTGCCTTGCAATACGTTCACGGCCA
GGGCATCATTCACCGGGATGTGAAACCGGACAACGTCCTCCTCGATGCCGATGGACACGTCCACTTGACAGACTT
TGTACGTTCCGCCGTCGCCTCGCCCGGAAGACGCCGTGGATCCTGACCGCTTCTAGAACGTCGCCTCCGACATCA
TACCCGGAAGAGTGCTCACGAGCAAGTCGGGGACCTTGGCCTATCTGGCCCCAGAGGTGTACGCCGGCAAGGGCT
ACGACGTTCGCGCGGACTGGTGGTCTCTGGGTGTGCTGTTCTACGAGTGCATTTACAACAAGGTGCGTCCCTTCC
ACACACGGGGCTCGTCTGGCTTTAGAGAACGCGTCTCGCGCCCGCGACTCCGGATAGGAGACGGCGACCGTCGGT
GCTAACCACTGGACAGCGGCCCTTTGAGGGGAGCAATGAAGCCACTCTCAGCCAACAGATCCAAAACAGCAGCCC
GAAATATCCCGTCACGCAGCCTCCCGTCTCGCTCACCTGTCTCTACGCCATCCGCGCCGCCCTGGATCCCAATCC
CAAGACACGTCTCGGCTCTACGTGGGAGAGCTTCATCCACAACGACTTCTTTCGCGAATTCGACTTTGACCTGCT
GGAGCAGAAGCGGATAGAGCCCATCTTCGTGCCGTCCTCGGACAAGACCAACTTTGACGCCACGTACGATCTGGA
GGAGCTGCTCCTCGAGGAGGCACCGCTCGAGGCTCGGGCCAGACGGCAGAAGCCGCGGGAGCGGTTAAAAGAGGA
CGCGACGCAGCAGGAAATCCGCGAGGACGAGCTGTACAGGATGATCGAAAAGGACTTTCGACCGTTCGACTACAC
GCTGGCTGCGTACCAAAAGTACGTCCCACCCCCCCCCCCCCCCCGGCCTCACCTTGCGCGGGGGCCACCGCTGAC
GCCGAAGGGCAGGATCACGGAGGCGACGCAAACCTTGGGCGAGGACGGCCAGCTTGTCGTGGCGCCGGGCGACGT
GCCGCAGGCCCTCACGACGGACGAAGCGACGCCGGCCCCGCAGCGGTCCAAGTCGACACACGCCGTCAAGCACCC
AATGGTCAACCGCGCCCACAGTGTGGAGAAGCGGCCGGGTCGCCCGTCGCGGCCCGCGGCGCCCGCGCCCCAGTA
CCAGAGCCAGTACGTCTCTCGGCCCTCGGCGCCGAGCAAGAACCGGGTGGCGAGCCCCTCCGGGGGCGTGCAGGT
GACGCTGGACGGAGGCGGCAGCTGGTCGGAGCTGGCGCGCCAGGACGCGACGCTGCCGGCCGACGCGAGCACCAT
GGCCGACCCCAAGGCCGAGGGCTCGGGAGGCATGTTCGGCTTCCTGAAGAGCAAGCGAAGCCGGAACAACAGCCC
GAAGCCGCGCGAGAGGGGCGTCCTCGGCAAGGAGGGCGCGCGGGTCGTCATCAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail