Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4006
Gene name
LocationContig_209:22939..24765
Strand+
Gene length (bp)1826
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08601 PAP1 Transcription factor PAP1 2.9E-08 237 377
PF08601 PAP1 Transcription factor PAP1 2.8E-58 390 532
PF00170 bZIP_1 bZIP transcription factor 9.6E-07 153 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56095|AP1_KLULA AP-1-like transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAP1 PE=3 SV=1 109 250 9.0E-20
sp|Q5AJU7|YAP1_CANAL AP-1-like transcription factor CAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP1 PE=1 SV=1 123 211 3.0E-16
sp|Q01663|AP1_SCHPO AP-1-like transcription factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pap1 PE=1 SV=2 135 212 8.0E-14
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 146 212 3.0E-10
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 479 534 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56095|AP1_KLULA AP-1-like transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAP1 PE=3 SV=1 109 250 9.0E-20
sp|Q5AJU7|YAP1_CANAL AP-1-like transcription factor CAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP1 PE=1 SV=1 123 211 3.0E-16
sp|Q01663|AP1_SCHPO AP-1-like transcription factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pap1 PE=1 SV=2 135 212 8.0E-14
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 146 212 3.0E-10
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 479 534 3.0E-08
sp|P56095|AP1_KLULA AP-1-like transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAP1 PE=3 SV=1 361 534 6.0E-08
sp|P24813|YAP2_YEAST AP-1-like transcription activator YAP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAD1 PE=1 SV=2 140 185 9.0E-08
sp|Q5AJU7|YAP1_CANAL AP-1-like transcription factor CAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP1 PE=1 SV=1 479 534 2.0E-07
sp|Q8X229|FCR3_CANAX Fluconazole resistance protein 3 OS=Candida albicans GN=FCR3 PE=3 SV=1 149 251 1.0E-06
sp|P40917|YAP4_YEAST AP-1-like transcription factor YAP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN5 PE=1 SV=1 95 210 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0009889 regulation of biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:2001141 regulation of RNA biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0140110 transcription regulator activity No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0019222 regulation of metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0065007 biological regulation No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0080090 regulation of primary metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2612 0.9765 0.0805 0.0175 0.0771 0.0017 0.0356 0.0095 0.0172 0.0082

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup776
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|734
Ophiocordyceps australis map64 (Brazil) OphauB2|448
Ophiocordyceps camponoti-floridani Ophcf2|01247
Ophiocordyceps camponoti-rufipedis Ophun1|3244
Ophiocordyceps kimflemingae Ophio5|2204
Ophiocordyceps subramaniannii Hirsu2|285
Ophiocordyceps subramaniannii Hirsu2|4006 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4006
MSSVGDQGGSVPPNFYLTPHQQNLLFAALNANRQPSPANGLSLSPNSLKGSPMQSLDSAGFQESPYLDNYDYDFG
DSSFDFSFASVDQHHMIGDAPATVKSDSTENESNDKRSHPDDEDAGDSPGNDSKRHESTDKAPKKPGRKPLTSEP
TSKRKAQNRAAQRAFRERKEKHLKDLETKVHELEKASEEANHENSKLRVQLDRITSELNQYKQRLAVLANTNKAA
PRDNLAFGNAVLNNLSDVSFQFEFPKFGTQPRSAADKASAASAANGQVPSPARSSSNDGRSPHSSRQPAPEEATK
FAGAPTPSMTSSRGPGSRASVDSGNASVGGAASSPSSTPNSNLSCGTSPEPSNQSPMGVKPFETLTTIGEEQPAL
PVAQQPFAQFAHVDIESPSFDWLANQNGGQFDPQLFGDYREPQDSILSNPNLDDFFNDALDADFMTPYNLPPAAT
AAAATAPKKNLIDEIDAKLDEDLPKDKNVKCAEIWERLQGCPNAQSGDFDLDGLCSELTKKAKCSGSGPVVAERD
FDSILQKYMGKDVSSQCVASRLGIEVHPNEKPNGVVML*
Coding >Hirsu2|4006
ATGTCTTCCGTCGGCGACCAGGGCGGCTCCGTGCCGCCCAACTTCTACTTGACCCCGCACCAGCAGAATCTGCTC
TTTGCCGCTCTCAATGCCAACCGCCAGCCCTCGCCAGCAAACGGCCTCTCGCTCTCGCCCAACTCGCTCAAAGGC
TCGCCCATGCAGTCCCTCGACAGCGCCGGGTTCCAGGAGAGCCCCTATCTCGACAACTACGACTACGACTTCGGC
GACTCCAGCTTCGACTTTTCCTTCGCCAGCGTCGACCAGCACCACATGATCGGCGACGCCCCGGCCACCGTCAAG
TCCGACTCGACCGAGAACGAATCCAACGACAAGAGGAGCCACCCGGACGACGAGGACGCCGGCGACAGCCCCGGC
AACGACTCCAAGCGCCATGAGAGCACCGACAAGGCACCCAAGAAGCCCGGCCGCAAGCCCCTGACGTCGGAGCCC
ACCTCGAAGCGCAAGGCCCAGAACCGAGCCGCGCAGCGTGCCTTCCGTGAGCGCAAGGAGAAGCACCTGAAGGAT
CTCGAGACCAAGGTGCACGAGCTGGAGAAGGCGTCCGAGGAGGCCAACCACGAGAACAGCAAGCTGCGCGTCCAG
CTGGACCGCATCACCTCCGAACTGAACCAGTACAAGCAGAGGCTGGCCGTCCTGGCCAACACCAACAAGGCCGCG
CCCAGGGACAACCTGGCCTTCGGCAACGCCGTCCTCAACAACCTCAGCGACGTGAGCTTCCAGTTCGAGTTTCCC
AAGTTCGGCACGCAGCCGCGGTCCGCCGCCGACAAGGCGTCGGCCGCGTCCGCCGCCAACGGACAGGTCCCGAGC
CCGGCCCGGAGCAGCAGCAACGACGGCCGGTCGCCGCACTCGAGCCGACAGCCCGCGCCGGAAGAGGCGACCAAG
TTCGCGGGCGCGCCCACGCCGTCCATGACGAGCTCGCGAGGGCCCGGCTCGCGCGCCAGCGTCGACTCCGGAAAC
GCCAGCGTCGGCGGCGCCGCCAGCTCGCCGTCGTCGACGCCCAACTCCAACCTGTCCTGCGGCACCTCGCCCGAG
CCGTCCAACCAGTCGCCGATGGGCGTCAAGCCGTTCGAGACGCTGACGACGATCGGCGAGGAGCAGCCGGCCCTG
CCGGTGGCGCAGCAGCCGTTCGCCCAGTTCGCCCACGTCGACATCGAGAGCCCCAGCTTCGACTGGCTGGCGAAC
CAGAACGGCGGCCAGTTCGACCCGCAGCTGTTCGGCGACTACCGCGAGCCCCAGGACAGCATCCTGTCCAACCCG
AACCTGGACGACTTCTTCAACGACGCCCTCGACGCCGACTTCATGACGCCCTACAACCTGCCCCCGGCGGCGACG
GCGGCGGCGGCGACGGCGCCCAAGAAGAACCTCATCGACGAGATCGACGCCAAGCTGGACGAGGACCTCCCCAAA
GACAAGAACGTGAAGTGTGCCGAGATTTGGGAGAGGCTGCAGGGCTGCCCCAACGCGCAGAGCGGCGACTTCGAC
CTCGACGGGCTCTGCTCCGAGCTGACCAAGAAGGCCAAGTGCTCGGGCAGCGGGCCGGTCGTGGCCGAGCGCGAC
TTCGACTCGATCCTGCAGAAGTACATGGGCAAGGACGTGTCGTCGCAGTGCGTCGCCAGCCGGCTCGGCATCGAG
GTGCACCCGAACGAGAAGCCCAACGGGGTCGTGATGCTGTGA
Transcript >Hirsu2|4006
ATGTCTTCCGTCGGCGACCAGGGCGGCTCCGTGCCGCCCAACTTCTACTTGACCCCGCACCAGCAGAATCTGCTC
TTTGCCGCTCTCAATGCCAACCGCCAGCCCTCGCCAGCAAACGGCCTCTCGCTCTCGCCCAACTCGCTCAAAGGC
TCGCCCATGCAGTCCCTCGACAGCGCCGGGTTCCAGGAGAGCCCCTATCTCGACAACTACGACTACGACTTCGGC
GACTCCAGCTTCGACTTTTCCTTCGCCAGCGTCGACCAGCACCACATGATCGGCGACGCCCCGGCCACCGTCAAG
TCCGACTCGACCGAGAACGAATCCAACGACAAGAGGAGCCACCCGGACGACGAGGACGCCGGCGACAGCCCCGGC
AACGACTCCAAGCGCCATGAGAGCACCGACAAGGCACCCAAGAAGCCCGGCCGCAAGCCCCTGACGTCGGAGCCC
ACCTCGAAGCGCAAGGCCCAGAACCGAGCCGCGCAGCGTGCCTTCCGTGAGCGCAAGGAGAAGCACCTGAAGGAT
CTCGAGACCAAGGTGCACGAGCTGGAGAAGGCGTCCGAGGAGGCCAACCACGAGAACAGCAAGCTGCGCGTCCAG
CTGGACCGCATCACCTCCGAACTGAACCAGTACAAGCAGAGGCTGGCCGTCCTGGCCAACACCAACAAGGCCGCG
CCCAGGGACAACCTGGCCTTCGGCAACGCCGTCCTCAACAACCTCAGCGACGTGAGCTTCCAGTTCGAGTTTCCC
AAGTTCGGCACGCAGCCGCGGTCCGCCGCCGACAAGGCGTCGGCCGCGTCCGCCGCCAACGGACAGGTCCCGAGC
CCGGCCCGGAGCAGCAGCAACGACGGCCGGTCGCCGCACTCGAGCCGACAGCCCGCGCCGGAAGAGGCGACCAAG
TTCGCGGGCGCGCCCACGCCGTCCATGACGAGCTCGCGAGGGCCCGGCTCGCGCGCCAGCGTCGACTCCGGAAAC
GCCAGCGTCGGCGGCGCCGCCAGCTCGCCGTCGTCGACGCCCAACTCCAACCTGTCCTGCGGCACCTCGCCCGAG
CCGTCCAACCAGTCGCCGATGGGCGTCAAGCCGTTCGAGACGCTGACGACGATCGGCGAGGAGCAGCCGGCCCTG
CCGGTGGCGCAGCAGCCGTTCGCCCAGTTCGCCCACGTCGACATCGAGAGCCCCAGCTTCGACTGGCTGGCGAAC
CAGAACGGCGGCCAGTTCGACCCGCAGCTGTTCGGCGACTACCGCGAGCCCCAGGACAGCATCCTGTCCAACCCG
AACCTGGACGACTTCTTCAACGACGCCCTCGACGCCGACTTCATGACGCCCTACAACCTGCCCCCGGCGGCGACG
GCGGCGGCGGCGACGGCGCCCAAGAAGAACCTCATCGACGAGATCGACGCCAAGCTGGACGAGGACCTCCCCAAA
GACAAGAACGTGAAGTGTGCCGAGATTTGGGAGAGGCTGCAGGGCTGCCCCAACGCGCAGAGCGGCGACTTCGAC
CTCGACGGGCTCTGCTCCGAGCTGACCAAGAAGGCCAAGTGCTCGGGCAGCGGGCCGGTCGTGGCCGAGCGCGAC
TTCGACTCGATCCTGCAGAAGTACATGGGCAAGGACGTGTCGTCGCAGTGCGTCGCCAGCCGGCTCGGCATCGAG
GTGCACCCGAACGAGAAGCCCAACGGGGTCGTGATGCTGTGA
Gene >Hirsu2|4006
ATGTCTTCCGTCGGCGACCAGGGCGGCTCCGTGCCGCCCAACTTCTACTTGACCCCGCACCAGCAGAATCTGCTC
TTTGCCGCTCTCAATGCCAACCGCCAGCCCTCGCCAGCAAACGGCCTCTCGCTCTCGCCCAACTCGCTCAAAGGC
TCGCCCATGCAGTCCCTCGACAGCGCCGGGTTCCAGGAGAGCCCCTATCTCGACAACTACGACTACGACTTCGGC
GACTCCAGCTTCGACTTTTCCTTCGCCAGCGTCGACCAGCACCACATGATCGGCGACGCCCCGGCCACCGTCAAG
TCCGACTCGACCGAGAACGAATCCAACGACAAGAGGAGCCACCCGGACGACGAGGACGCCGGCGACAGCCCCGGC
AACGACTCCAAGCGCCATGAGAGCACCGACAAGGCACCCAAGAAGCCCGGCCGCAAGCCCCTGACGTCGGAGCCC
ACCTCGGTAAGTACCCGCCGACCGACGACGGCTCACCATCCTGACAGCCTACCCCCCAGAAGCGCAAGGCCCAGA
ACCGAGCCGCGCAGCGTGCCTTCCGTGAGCGCAAGGAGAAGCACCTGAAGGATCTCGAGACCAAGGTGCACGAGC
TGGAGAAGGCGTCCGAGGAGGCCAACCACGAGAACAGCAAGCTGCGCGTCCAGCTGGACCGCATCACCTCCGAAC
TGAACCAGTACAAGCAGAGGCTGGCCGTCCTGGCCAACACCAACAAGGCCGCGCCCAGGGACAACCTGGCCTTCG
GCAACGCCGTCCTCAACAACCTCAGCGACGTGAGCTTCCAGTTCGAGTTTCCCAAGTTCGGCACGCAGCCGCGGT
CCGCCGCCGACAAGGCGTCGGCCGCGTCCGCCGCCAACGGACAGGTCCCGAGCCCGGCCCGGAGCAGCAGCAACG
ACGGCCGGTCGCCGCACTCGAGCCGACAGCCCGCGCCGGAAGAGGCGACCAAGTTCGCGGGCGCGCCCACGCCGT
CCATGACGAGCTCGCGAGGGCCCGGCTCGCGCGCCAGCGTCGACTCCGGAAACGCCAGCGTCGGCGGCGCCGCCA
GCTCGCCGTCGTCGACGCCCAACTCCAACCTGTCCTGCGGCACCTCGCCCGAGCCGTCCAACCAGTCGCCGATGG
GCGTCAAGCCGTTCGAGACGCTGACGACGATCGGCGAGGAGCAGCCGGCCCTGCCGGTGGCGCAGCAGCCGTTCG
CCCAGTTCGCCCACGTCGACATCGAGAGCCCCAGCTTCGACTGGCTGGCGAACCAGAACGGCGGCCAGTTCGACC
CGCAGCTGTTCGGCGACTACCGCGAGCCCCAGGACAGCATCCTGTCCAACCCGAACCTGGACGACTTCTTCAACG
ACGCCCTCGACGCCGACTTCATGACGCCCTACAACCTGCCCCCGGCGGCGACGGCGGCGGCGGCGACGGCGCCCA
AGAAGAACCTCATCGACGAGATCGACGCCAAGCTGGACGAGGACCTCCCCAAAGACAAGAACGTGAAGTGTGCCG
AGATTTGGTACGTCCCCCTCCCCTCCCCCTCCCGCCCTTCCTACCGGCCAAGGCCCGAGAAGACGGCTCGACTGA
CAGGCCAATGCAGGGAGAGGCTGCAGGGCTGCCCCAACGCGCAGAGCGGCGACTTCGACCTCGACGGGCTCTGCT
CCGAGCTGACCAAGAAGGCCAAGTGCTCGGGCAGCGGGCCGGTCGTGGCCGAGCGCGACTTCGACTCGATCCTGC
AGAAGTACATGGGCAAGGACGTGTCGTCGCAGTGCGTCGCCAGCCGGCTCGGCATCGAGGTGCACCCGAACGAGA
AGCCCAACGGGGTCGTGATGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail