Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4004
Gene name
LocationContig_209:16288..17596
Strand-
Gene length (bp)1308
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03909 BSD BSD domain 5.5E-18 236 293

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13905|YF3E_SCHPO BSD domain-containing protein C22A12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.14c PE=1 SV=1 149 316 2.0E-19
sp|A2BIJ3|BSDC1_DANRE BSD domain-containing protein 1 OS=Danio rerio GN=bsdc1 PE=1 SV=1 169 309 1.0E-10
sp|Q6NTW1|BSC1B_XENLA BSD domain-containing protein 1-B OS=Xenopus laevis GN=bsdc1-b PE=2 SV=1 212 302 1.0E-10
sp|Q5BJ78|BSDC1_XENTR BSD domain-containing protein 1 OS=Xenopus tropicalis GN=bsdc1 PE=2 SV=1 157 301 2.0E-10
sp|Q6INU2|BSC1A_XENLA BSD domain-containing protein 1-A OS=Xenopus laevis GN=bsdc1-a PE=2 SV=1 212 301 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13905|YF3E_SCHPO BSD domain-containing protein C22A12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.14c PE=1 SV=1 149 316 2.0E-19
sp|A2BIJ3|BSDC1_DANRE BSD domain-containing protein 1 OS=Danio rerio GN=bsdc1 PE=1 SV=1 169 309 1.0E-10
sp|Q6NTW1|BSC1B_XENLA BSD domain-containing protein 1-B OS=Xenopus laevis GN=bsdc1-b PE=2 SV=1 212 302 1.0E-10
sp|Q5BJ78|BSDC1_XENTR BSD domain-containing protein 1 OS=Xenopus tropicalis GN=bsdc1 PE=2 SV=1 157 301 2.0E-10
sp|Q6INU2|BSC1A_XENLA BSD domain-containing protein 1-A OS=Xenopus laevis GN=bsdc1-a PE=2 SV=1 212 301 2.0E-10
sp|Q80Y55|BSDC1_MOUSE BSD domain-containing protein 1 OS=Mus musculus GN=Bsdc1 PE=1 SV=1 212 301 6.0E-09
sp|Q9NW68|BSDC1_HUMAN BSD domain-containing protein 1 OS=Homo sapiens GN=BSDC1 PE=1 SV=1 212 301 1.0E-08
sp|Q3SX22|BSDC1_BOVIN BSD domain-containing protein 1 OS=Bos taurus GN=BSDC1 PE=2 SV=1 212 301 1.0E-08
sp|Q5ZIK6|BSDC1_CHICK BSD domain-containing protein 1 OS=Gallus gallus GN=BSDC1 PE=2 SV=1 212 301 6.0E-08
sp|P54858|DOS2_YEAST Protein DOS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOS2 PE=1 SV=1 208 298 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4004
MDLAYDHIQADAYARDQDDSSGTPKPEQQSSLNSDIQDAYKAISSSAWGIKIGGFLGTVVKQGESVYNQASKELA
EVGEDATKGFSDLRDTIINRTRSLTQTTATEANSKDGDDSQSTPTRSMAPPSEDAMQQPETVLSRLRSEAAKRLR
DLQQAEDAADEALLRFGGNVRDFLRDAITIAPPEESDETNTVLFESKDAQGKRVIHTSRFDAQLHVIHTSAERFT
EDPAGVEFDSWAKDFDIDRRTEDISSDLAKYPELRETMEKLVPGQIPYPDFWKRYYYVRHGIETAESRRRDLLQA
ASAEDEVGWDDDSEDEAAEKQPKTSRGKTASVASSTTIQPQAQGHLKPTESRKSNDEKSVADSEASYDVVGATSG
KTSQAPNSPKDPKRAEDSDDDWE*
Coding >Hirsu2|4004
ATGGATCTCGCCTACGATCACATTCAGGCGGATGCCTACGCGAGGGATCAGGATGATTCCTCCGGCACCCCGAAA
CCCGAGCAGCAGTCGTCTCTCAACAGTGACATCCAAGACGCGTACAAGGCCATATCCTCCAGCGCCTGGGGCATC
AAGATCGGCGGCTTCTTAGGGACTGTTGTCAAGCAGGGCGAGTCCGTGTACAACCAGGCGTCCAAGGAGCTCGCC
GAAGTCGGCGAGGACGCGACCAAGGGTTTTTCAGACCTTCGAGATACCATCATCAACCGCACAAGATCCTTGACC
CAGACCACTGCCACCGAGGCGAATTCCAAGGATGGGGATGACAGCCAGTCCACGCCGACAAGGTCGATGGCCCCT
CCTTCCGAGGACGCCATGCAGCAACCGGAGACCGTCCTCTCGCGTCTCCGTTCCGAGGCCGCCAAACGTCTCAGA
GACCTCCAACAGGCCGAAGACGCCGCGGACGAGGCCCTTTTGCGCTTCGGCGGCAACGTACGCGACTTCCTCCGA
GACGCCATCACGATCGCGCCGCCCGAGGAGTCGGACGAGACCAACACGGTACTGTTTGAGAGCAAGGATGCGCAG
GGCAAGAGGGTGATCCACACGTCCCGATTCGACGCCCAGCTGCACGTGATACACACGTCGGCCGAGCGCTTCACC
GAGGACCCGGCCGGTGTCGAGTTCGACAGTTGGGCCAAGGACTTTGACATTGACCGCAGGACCGAGGACATAAGT
AGCGACCTCGCCAAGTATCCCGAGCTGCGGGAAACGATGGAGAAGCTGGTGCCGGGCCAGATCCCCTACCCCGAT
TTCTGGAAGCGGTACTATTATGTCCGACACGGCATTGAGACGGCCGAGTCTAGGCGACGCGATCTCCTCCAAGCC
GCATCGGCCGAGGACGAGGTCGGATGGGACGACGATTCCGAGGACGAGGCTGCCGAGAAGCAGCCAAAGACGTCA
CGGGGCAAGACGGCCTCGGTGGCGTCATCTACAACCATCCAGCCCCAGGCGCAAGGCCACCTGAAGCCAACCGAG
TCGCGGAAATCAAACGACGAAAAGTCCGTGGCCGATAGCGAGGCCAGCTACGACGTCGTAGGCGCCACGTCGGGC
AAGACGAGCCAGGCGCCCAACAGCCCCAAAGACCCAAAAAGGGCCGAAGACAGCGACGACGACTGGGAGTAA
Transcript >Hirsu2|4004
ATGGATCTCGCCTACGATCACATTCAGGCGGATGCCTACGCGAGGGATCAGGATGATTCCTCCGGCACCCCGAAA
CCCGAGCAGCAGTCGTCTCTCAACAGTGACATCCAAGACGCGTACAAGGCCATATCCTCCAGCGCCTGGGGCATC
AAGATCGGCGGCTTCTTAGGGACTGTTGTCAAGCAGGGCGAGTCCGTGTACAACCAGGCGTCCAAGGAGCTCGCC
GAAGTCGGCGAGGACGCGACCAAGGGTTTTTCAGACCTTCGAGATACCATCATCAACCGCACAAGATCCTTGACC
CAGACCACTGCCACCGAGGCGAATTCCAAGGATGGGGATGACAGCCAGTCCACGCCGACAAGGTCGATGGCCCCT
CCTTCCGAGGACGCCATGCAGCAACCGGAGACCGTCCTCTCGCGTCTCCGTTCCGAGGCCGCCAAACGTCTCAGA
GACCTCCAACAGGCCGAAGACGCCGCGGACGAGGCCCTTTTGCGCTTCGGCGGCAACGTACGCGACTTCCTCCGA
GACGCCATCACGATCGCGCCGCCCGAGGAGTCGGACGAGACCAACACGGTACTGTTTGAGAGCAAGGATGCGCAG
GGCAAGAGGGTGATCCACACGTCCCGATTCGACGCCCAGCTGCACGTGATACACACGTCGGCCGAGCGCTTCACC
GAGGACCCGGCCGGTGTCGAGTTCGACAGTTGGGCCAAGGACTTTGACATTGACCGCAGGACCGAGGACATAAGT
AGCGACCTCGCCAAGTATCCCGAGCTGCGGGAAACGATGGAGAAGCTGGTGCCGGGCCAGATCCCCTACCCCGAT
TTCTGGAAGCGGTACTATTATGTCCGACACGGCATTGAGACGGCCGAGTCTAGGCGACGCGATCTCCTCCAAGCC
GCATCGGCCGAGGACGAGGTCGGATGGGACGACGATTCCGAGGACGAGGCTGCCGAGAAGCAGCCAAAGACGTCA
CGGGGCAAGACGGCCTCGGTGGCGTCATCTACAACCATCCAGCCCCAGGCGCAAGGCCACCTGAAGCCAACCGAG
TCGCGGAAATCAAACGACGAAAAGTCCGTGGCCGATAGCGAGGCCAGCTACGACGTCGTAGGCGCCACGTCGGGC
AAGACGAGCCAGGCGCCCAACAGCCCCAAAGACCCAAAAAGGGCCGAAGACAGCGACGACGACTGGGAGTAA
Gene >Hirsu2|4004
ATGGATCTCGCCTACGATCACATTCAGGCGGATGCCTACGCGAGGGATCAGGATGATTCCTCCGGCACCCCGAAA
CCCGAGCAGCAGTCGTCTCTCAACAGTGACATCCAAGACGCGTACAAGGCCATATCCTCCAGCGCCTGGGGCATC
AAGATCGGCGGCTTCTTAGGGACTGTTGTCAAGCAGGTACCAGTCCGGCCCGTTGCCTTGCATGCCGTCAGCGGC
CCCATCCTGACCTGCGCAGGGCGAGTCCGTGTACAACCAGGCGTCCAAGGAGCTCGCCGAAGTCGGCGAGGACGC
GACCAAGGGTTTTTCAGACCTTCGAGATACCATCATCAACCGCACAAGATCCTTGACCCAGACCACTGCCACCGA
GGCGAATTCCAAGGATGGGGATGACAGCCAGTCCACGCCGACAAGGTCGATGGCCCCTCCTTCCGAGGACGCCAT
GCAGCAACCGGAGACCGTCCTCTCGCGTCTCCGTTCCGAGGCCGCCAAACGTCTCAGAGACCTCCAACAGGCCGA
AGACGCCGCGGACGAGGCCCTTTTGCGCTTCGGCGGCAACGTACGCGACTTCCTCCGAGACGCCATCACGATCGC
GCCGCCCGAGGAGTCGGACGAGACCAACACGGTACTGTTTGAGAGCAAGGATGCGCAGGGCAAGAGGGTGATCCA
CACGTCCCGATTCGACGCCCAGCTGCACGTGATACACACGTCGGCCGAGCGCTTCACCGAGGACCCGGCCGGTGT
CGAGTTCGACAGTTGGGCCAAGGACTTTGACATTGACCGCAGGACCGAGGACATAAGTAGCGACCTCGCCAAGTA
TCCCGAGCTGCGGGAAACGATGGAGAAGCTGGTGCCGGGCCAGATCCCCTACCCCGATTTCTGGAAGCGGTACTA
TTATGTCCGACACGGCATTGAGACGGCCGAGTCTAGGCGACGCGATCTCCTCCAAGGTCTAGTCAAGCCATTTAT
CACAAGGCCCGCCACTGTGCTAATGCTCCCGCAGCCGCATCGGCCGAGGACGAGGTCGGATGGGACGACGATTCC
GAGGACGAGGCTGCCGAGAAGCAGCCAAAGACGTCACGGGGCAAGACGGCCTCGGTGGCGTCATCTACAACCATC
CAGCCCCAGGCGCAAGGCCACCTGAAGCCAACCGAGTCGCGGAAATCAAACGACGAAAAGTCCGTGGCCGATAGC
GAGGCCAGCTACGACGTCGTAGGCGCCACGTCGGGCAAGACGAGCCAGGCGCCCAACAGCCCCAAAGACCCAAAA
AGGGCCGAAGACAGCGACGACGACTGGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail