Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|400
Gene name
LocationContig_1079:4285..6154
Strand-
Gene length (bp)1869
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07534 TLD TLD 3.0E-28 348 542
PF08593 DUF1773 Domain of unknown function 8.4E-10 294 339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E3QLU5|RTC5_COLGM Restriction of telomere capping protein 5 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=RTC5 PE=3 SV=1 1 597 0.0E+00
sp|C7YJ03|RTC5_NECH7 Restriction of telomere capping protein 5 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RTC5 PE=3 SV=1 1 597 0.0E+00
sp|D1ZRF1|RTC5_SORMK Restriction of telomere capping protein 5 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=RTC5 PE=3 SV=1 1 553 0.0E+00
sp|A4RI88|RTC5_MAGO7 Restriction of telomere capping protein 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RTC5 PE=3 SV=1 1 596 0.0E+00
sp|Q7S454|RTC5_NEUCR Restriction of telomere capping protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rtc5 PE=3 SV=2 1 597 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E3QLU5|RTC5_COLGM Restriction of telomere capping protein 5 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=RTC5 PE=3 SV=1 1 597 0.0E+00
sp|C7YJ03|RTC5_NECH7 Restriction of telomere capping protein 5 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RTC5 PE=3 SV=1 1 597 0.0E+00
sp|D1ZRF1|RTC5_SORMK Restriction of telomere capping protein 5 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=RTC5 PE=3 SV=1 1 553 0.0E+00
sp|A4RI88|RTC5_MAGO7 Restriction of telomere capping protein 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RTC5 PE=3 SV=1 1 596 0.0E+00
sp|Q7S454|RTC5_NEUCR Restriction of telomere capping protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rtc5 PE=3 SV=2 1 597 0.0E+00
sp|E4ZUJ1|RTC5_LEPMJ Restriction of telomere capping protein 5 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=RTC5 PE=3 SV=1 1 597 4.0E-165
sp|E3RYW5|RTC5_PYRTT Restriction of telomere capping protein 5 OS=Pyrenophora teres f. teres (strain 0-1) GN=rtc5 PE=3 SV=1 1 597 7.0E-148
sp|B2WB15|RTC5_PYRTR Restriction of telomere capping protein 5 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rtc5 PE=3 SV=1 16 597 4.0E-144
sp|B6QHL1|RTC5_TALMQ Restriction of telomere capping protein 5 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rtc5 PE=3 SV=1 16 596 4.0E-78
sp|Q2UGP9|RTC5_ASPOR Restriction of telomere capping protein 5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rtc5 PE=3 SV=1 1 596 5.0E-78
sp|B8N9M5|RTC5_ASPFN Restriction of telomere capping protein 5 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rtc5 PE=3 SV=1 1 596 5.0E-78
sp|B6H464|RTC5_PENRW Restriction of telomere capping protein 5 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rtc5 PE=3 SV=1 1 588 3.0E-74
sp|B8MJJ8|RTC5_TALSN Restriction of telomere capping protein 5 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rtc5 PE=3 SV=1 14 596 3.0E-74
sp|A2QI73|RTC5_ASPNC Restriction of telomere capping protein 5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rtc5 PE=3 SV=1 2 587 2.0E-73
sp|A1CHC0|RTC5_ASPCL Restriction of telomere capping protein 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rtc5 PE=3 SV=1 1 596 7.0E-72
sp|Q5B6J2|RTC5_EMENI Restriction of telomere capping protein 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rtc5 PE=3 SV=1 16 594 8.0E-71
sp|Q4WP54|RTC5_ASPFU Restriction of telomere capping protein 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rtc5 PE=3 SV=2 1 596 1.0E-70
sp|B0Y601|RTC5_ASPFC Restriction of telomere capping protein 5 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rtc5 PE=3 SV=1 1 596 1.0E-70
sp|A1CXG7|RTC5_NEOFI Restriction of telomere capping protein 5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rtc5 PE=3 SV=1 1 596 2.0E-69
sp|C1GYL0|RTC5_PARBA Restriction of telomere capping protein 5 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=RTC5 PE=3 SV=1 1 594 9.0E-68
sp|C0RYV6|RTC5_PARBP Restriction of telomere capping protein 5 OS=Paracoccidioides brasiliensis (strain Pb03) GN=RTC5 PE=3 SV=1 1 594 2.0E-66
sp|D4DDJ7|RTC5_TRIVH Restriction of telomere capping protein 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=RTC5 PE=3 SV=1 14 588 4.0E-66
sp|C1G788|RTC5_PARBD Restriction of telomere capping protein 5 OS=Paracoccidioides brasiliensis (strain Pb18) GN=RTC5 PE=3 SV=1 1 594 2.0E-65
sp|E4UPA0|RTC5_ARTGP Restriction of telomere capping protein 5 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=RTC5 PE=3 SV=1 2 588 2.0E-65
sp|C5P441|RTC5_COCP7 Restriction of telomere capping protein 5 OS=Coccidioides posadasii (strain C735) GN=RTC5 PE=3 SV=1 12 588 5.0E-65
sp|C5FSR3|RTC5_ARTOC Restriction of telomere capping protein 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RTC5 PE=3 SV=1 2 590 5.0E-65
sp|D4AVK1|RTC5_ARTBC Restriction of telomere capping protein 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=RTC5 PE=3 SV=1 14 588 2.0E-64
sp|C5GFG2|RTC5_AJEDR Restriction of telomere capping protein 5 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=RTC5 PE=3 SV=1 1 588 1.0E-62
sp|C5JIS5|RTC5_AJEDS Restriction of telomere capping protein 5 OS=Ajellomyces dermatitidis (strain SLH14081) GN=RTC5 PE=3 SV=1 1 588 1.0E-62
sp|A6RBC0|RTC5_AJECN Restriction of telomere capping protein 5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RTC5 PE=3 SV=1 1 594 3.0E-62
sp|C4R3K5|RTC5_PICPG Restriction of telomere capping protein 5 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RTC5 PE=3 SV=1 1 596 2.0E-61
sp|C6H208|RTC5_AJECH Restriction of telomere capping protein 5 OS=Ajellomyces capsulatus (strain H143) GN=RTC5 PE=3 SV=1 1 588 5.0E-60
sp|C4JHR8|RTC5_UNCRE Restriction of telomere capping protein 5 OS=Uncinocarpus reesii (strain UAMH 1704) GN=RTC5 PE=3 SV=1 12 588 9.0E-58
sp|Q6CB30|RTC5_YARLI Restriction of telomere capping protein 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RTC5 PE=3 SV=1 1 596 7.0E-57
sp|Q6CMD3|RTC5_KLULA Restriction of telomere capping protein 5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RTC5 PE=3 SV=1 1 596 1.0E-51
sp|C5DJG1|RTC5_LACTC Restriction of telomere capping protein 5 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RTC5 PE=3 SV=1 76 596 3.0E-48
sp|Q6FKH1|RTC5_CANGA Restriction of telomere capping protein 5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RTC5 PE=3 SV=1 1 596 6.0E-48
sp|A5DMB8|RTC5_PICGU Restriction of telomere capping protein 5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RTC5 PE=3 SV=2 74 596 6.0E-47
sp|Q756J6|RTC5_ASHGO Restriction of telomere capping protein 5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RTC5 PE=3 SV=2 52 596 7.0E-47
sp|Q6BHX4|RTC5_DEBHA Restriction of telomere capping protein 5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RTC5 PE=3 SV=2 1 596 1.0E-46
sp|C5DY36|RTC5_ZYGRC Restriction of telomere capping protein 5 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RTC5 PE=3 SV=1 29 596 8.0E-46
sp|C4Y146|RTC5_CLAL4 Restriction of telomere capping protein 5 OS=Clavispora lusitaniae (strain ATCC 42720) GN=RTC5 PE=3 SV=1 57 596 3.0E-45
sp|A7TNS4|RTC5_VANPO Restriction of telomere capping protein 5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RTC5 PE=3 SV=1 1 596 8.0E-43
sp|A3LQG3|RTC5_PICST Restriction of telomere capping protein 5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RTC5 PE=3 SV=2 73 596 4.0E-42
sp|A6ZNW6|RTC5_YEAS7 Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain YJM789) GN=RTC5 PE=3 SV=1 76 596 5.0E-42
sp|Q12108|RTC5_YEAST Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC5 PE=1 SV=1 76 596 2.0E-41
sp|C8ZI80|RTC5_YEAS8 Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RTC5 PE=3 SV=1 76 596 2.0E-41
sp|C7GML8|RTC5_YEAS2 Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain JAY291) GN=RTC5 PE=3 SV=1 76 596 2.0E-41
sp|B3LJG1|RTC5_YEAS1 Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RTC5 PE=3 SV=1 76 596 2.0E-41
sp|C5MCY0|RTC5_CANTT Restriction of telomere capping protein 5 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RTC5 PE=3 SV=1 1 596 3.0E-41
sp|A5DSQ8|RTC5_LODEL Restriction of telomere capping protein 5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RTC5 PE=3 SV=1 349 596 7.0E-38
sp|O94644|RTC5_SCHPO Restriction of telomere capping protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtc5 PE=3 SV=1 207 540 9.0E-21
sp|B6K4Q8|RTC5_SCHJY Restriction of telomere capping protein 5 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rtc5 PE=3 SV=1 194 540 9.0E-13
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal|Nuclear export signal 0.6158 0.4685 0.0362 0.1775 0.2106 0.0312 0.1423 0.3683 0.5146 0.0262

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2620
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2971
Ophiocordyceps australis map64 (Brazil) OphauB2|6328
Ophiocordyceps camponoti-floridani Ophcf2|02367
Ophiocordyceps camponoti-rufipedis Ophun1|689
Ophiocordyceps kimflemingae Ophio5|4158
Ophiocordyceps subramaniannii Hirsu2|400 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|400
MGQTLSDEQPRRRSREELTHELAYKFKNKCFTSLEYYSLKDVFKSLADQQGPVRYLKEDTVARYLEIPDILGASP
VVFHMVSYLGAFPFLQDAPVVLELPRLIMVVVIMTERYRRVLARGSSDRSKLLFKSLAVYDRKISEAMNTGPDPG
SGPDVAPATGFAVDATGGDAENEDEDDDDLVLTAYELLDVTEAVRQGAAPDFHGAIIPTDNFRRLLMLLLLAAPL
SPQECLSQFSSGVAGDQLEQLRSTSEHMLASFVDAETSPGVKYRHFKAVLPVLFPNLFCGFNGLFERLLFSKNLD
FSRHGNEARPPAAAQPLLSDVGEILNDHVLSQISMFLPGSSLFRRVRLLYSGSSAGFSMGSFESTVFHWRAPTLL
LVSGTRLGDVPDGGQEAAFAESLPTKRFPPGSKSGRVTYGVYVREPWKHTSRGCFGDSETVLFQLEPIHDVFPAS
TMNTDYVAFTKSSGNQQCLSFGCPHPRQTQSQRRDGSFALGSVSLLLNDSFEFGVFNHDYRSRGGAFHTSLTRKL
DFQDRFQIEKLEVWGCGGDAEAKAQAERWAWEEREAEARRKINLGTGDIAADRALLEMAGLVGANRSGGSMG*
Coding >Hirsu2|400
ATGGGCCAGACGCTGTCCGACGAGCAGCCGCGCCGGCGGTCGCGCGAGGAGCTGACGCATGAGCTCGCCTACAAG
TTCAAGAACAAATGCTTCACCTCCCTCGAGTACTACTCGCTCAAGGATGTCTTCAAGAGCCTAGCCGACCAGCAG
GGCCCGGTGCGCTATCTCAAGGAGGACACCGTGGCCCGGTACCTCGAGATCCCAGACATTCTCGGCGCCTCGCCC
GTCGTCTTTCACATGGTCTCGTACCTCGGCGCCTTCCCCTTTCTCCAGGACGCGCCCGTCGTGCTGGAGCTGCCG
CGCCTCATCATGGTCGTGGTCATCATGACGGAGCGGTACCGCCGCGTCCTGGCCCGCGGCTCCTCCGACAGATCC
AAGCTCCTCTTCAAAAGCCTGGCCGTCTATGACCGCAAGATTTCCGAGGCCATGAATACGGGCCCCGATCCGGGC
TCGGGTCCGGATGTGGCCCCCGCCACGGGCTTCGCCGTGGATGCCACCGGCGGAGACGCCGAAAACGAAGACGAA
GACGACGACGACTTGGTGCTCACAGCCTATGAACTACTTGACGTGACAGAGGCCGTCCGACAAGGCGCCGCGCCA
GACTTTCACGGCGCCATCATCCCGACCGACAACTTCCGAAGGCTCCTTATGCTACTACTTCTCGCCGCGCCATTG
AGCCCCCAAGAGTGCCTCTCCCAGTTTTCGAGCGGCGTGGCGGGCGACCAGCTCGAGCAGCTGCGGTCGACGTCC
GAGCATATGCTTGCCTCGTTTGTCGACGCCGAAACGTCTCCCGGAGTCAAGTACAGGCACTTCAAGGCCGTTCTC
CCCGTCCTCTTCCCCAACCTCTTCTGCGGCTTCAACGGCCTTTTCGAGCGCCTTCTCTTTTCCAAGAACCTCGAC
TTTTCGCGGCACGGGAACGAGGCGAGACCGCCGGCCGCCGCGCAGCCGTTGCTGTCCGACGTGGGCGAGATTCTC
AACGACCACGTGCTGTCGCAAATCTCCATGTTCCTCCCCGGATCCTCCCTGTTCCGGAGAGTGCGGCTGCTGTAC
TCGGGAAGTAGTGCCGGTTTCTCGATGGGCAGCTTCGAGTCAACAGTCTTTCACTGGCGGGCACCCACGCTACTG
TTGGTGAGCGGGACCCGGCTGGGCGACGTGCCGGACGGCGGGCAGGAGGCGGCCTTTGCCGAGTCGCTGCCGACG
AAGCGCTTTCCTCCCGGCAGCAAGTCCGGCCGGGTCACGTACGGGGTCTACGTGCGGGAGCCCTGGAAGCACACC
AGCCGGGGCTGCTTCGGCGACTCGGAGACGGTCCTCTTTCAGCTCGAGCCCATCCACGATGTCTTTCCCGCCTCG
ACCATGAACACCGACTACGTCGCCTTCACCAAGTCGTCCGGCAACCAGCAGTGCCTGTCGTTCGGCTGCCCGCAC
CCGAGGCAGACGCAGTCGCAACGCAGAGACGGCTCCTTTGCCCTGGGATCCGTGTCCCTGCTGCTCAACGACTCC
TTCGAGTTTGGCGTCTTCAACCACGACTACAGGTCCCGCGGCGGGGCCTTCCACACGAGCCTGACGAGGAAGCTG
GACTTCCAGGACCGCTTCCAGATCGAGAAGCTCGAGGTCTGGGGCTGCGGGGGGGACGCCGAGGCAAAGGCTCAG
GCCGAGCGGTGGGCGTGGGAGGAGAGGGAGGCGGAGGCGCGGCGGAAGATCAACCTCGGGACGGGAGATATTGCC
GCGGACAGGGCGTTGCTGGAGATGGCCGGTCTCGTCGGCGCGAACCGCAGCGGAGGATCCATGGGGTGA
Transcript >Hirsu2|400
ATGGGCCAGACGCTGTCCGACGAGCAGCCGCGCCGGCGGTCGCGCGAGGAGCTGACGCATGAGCTCGCCTACAAG
TTCAAGAACAAATGCTTCACCTCCCTCGAGTACTACTCGCTCAAGGATGTCTTCAAGAGCCTAGCCGACCAGCAG
GGCCCGGTGCGCTATCTCAAGGAGGACACCGTGGCCCGGTACCTCGAGATCCCAGACATTCTCGGCGCCTCGCCC
GTCGTCTTTCACATGGTCTCGTACCTCGGCGCCTTCCCCTTTCTCCAGGACGCGCCCGTCGTGCTGGAGCTGCCG
CGCCTCATCATGGTCGTGGTCATCATGACGGAGCGGTACCGCCGCGTCCTGGCCCGCGGCTCCTCCGACAGATCC
AAGCTCCTCTTCAAAAGCCTGGCCGTCTATGACCGCAAGATTTCCGAGGCCATGAATACGGGCCCCGATCCGGGC
TCGGGTCCGGATGTGGCCCCCGCCACGGGCTTCGCCGTGGATGCCACCGGCGGAGACGCCGAAAACGAAGACGAA
GACGACGACGACTTGGTGCTCACAGCCTATGAACTACTTGACGTGACAGAGGCCGTCCGACAAGGCGCCGCGCCA
GACTTTCACGGCGCCATCATCCCGACCGACAACTTCCGAAGGCTCCTTATGCTACTACTTCTCGCCGCGCCATTG
AGCCCCCAAGAGTGCCTCTCCCAGTTTTCGAGCGGCGTGGCGGGCGACCAGCTCGAGCAGCTGCGGTCGACGTCC
GAGCATATGCTTGCCTCGTTTGTCGACGCCGAAACGTCTCCCGGAGTCAAGTACAGGCACTTCAAGGCCGTTCTC
CCCGTCCTCTTCCCCAACCTCTTCTGCGGCTTCAACGGCCTTTTCGAGCGCCTTCTCTTTTCCAAGAACCTCGAC
TTTTCGCGGCACGGGAACGAGGCGAGACCGCCGGCCGCCGCGCAGCCGTTGCTGTCCGACGTGGGCGAGATTCTC
AACGACCACGTGCTGTCGCAAATCTCCATGTTCCTCCCCGGATCCTCCCTGTTCCGGAGAGTGCGGCTGCTGTAC
TCGGGAAGTAGTGCCGGTTTCTCGATGGGCAGCTTCGAGTCAACAGTCTTTCACTGGCGGGCACCCACGCTACTG
TTGGTGAGCGGGACCCGGCTGGGCGACGTGCCGGACGGCGGGCAGGAGGCGGCCTTTGCCGAGTCGCTGCCGACG
AAGCGCTTTCCTCCCGGCAGCAAGTCCGGCCGGGTCACGTACGGGGTCTACGTGCGGGAGCCCTGGAAGCACACC
AGCCGGGGCTGCTTCGGCGACTCGGAGACGGTCCTCTTTCAGCTCGAGCCCATCCACGATGTCTTTCCCGCCTCG
ACCATGAACACCGACTACGTCGCCTTCACCAAGTCGTCCGGCAACCAGCAGTGCCTGTCGTTCGGCTGCCCGCAC
CCGAGGCAGACGCAGTCGCAACGCAGAGACGGCTCCTTTGCCCTGGGATCCGTGTCCCTGCTGCTCAACGACTCC
TTCGAGTTTGGCGTCTTCAACCACGACTACAGGTCCCGCGGCGGGGCCTTCCACACGAGCCTGACGAGGAAGCTG
GACTTCCAGGACCGCTTCCAGATCGAGAAGCTCGAGGTCTGGGGCTGCGGGGGGGACGCCGAGGCAAAGGCTCAG
GCCGAGCGGTGGGCGTGGGAGGAGAGGGAGGCGGAGGCGCGGCGGAAGATCAACCTCGGGACGGGAGATATTGCC
GCGGACAGGGCGTTGCTGGAGATGGCCGGTCTCGTCGGCGCGAACCGCAGCGGAGGATCCATGGGGTGA
Gene >Hirsu2|400
ATGGGCCAGACGCTGTCCGACGAGCAGCCGCGCCGGCGGTCGCGCGAGGAGCTGACGCATGAGCTCGTGAGCCGC
CATGTGCCCCTGCTCCGCCGCTGTCGAGGCGTCGCCGCCACTTGCTGACCTGGCCGCACTGCCCAGGCCTACAAG
TTCAAGAACAAATGCTTCACCTCCCTCGAGTACTACTCGCTCAAGGATGTCTTCAAGAGCCTAGCCGACCAGCAG
GGCCCGGTGCGCTATCTCAAGGAGGACACCGTGGCCCGGTACCTCGAGATCCCAGACATTCTCGGCGCCTCGCCC
GTCGTCTTTCACATGGTCTCGTACCTCGGCGCCTTCCCCTTTCTCCAGGACGCGCCCGTCGTGCTGGAGCTGCCG
CGCCTCATCATGGTCGTGGTCATCATGACGGAGCGGTACCGCCGCGTCCTGGCCCGCGGCTCCTCCGACAGATCC
AAGCTCCTCTTCAAAAGCCTGGCCGTCTATGACCGCAAGATTTCCGAGGCCATGAATACGGGCCCCGATCCGGGC
TCGGGTCCGGATGTGGCCCCCGCCACGGGCTTCGCCGTGGATGCCACCGGCGGAGACGCCGAAAACGAAGACGAA
GACGACGACGACTTGGTGCTCACAGCCTATGAACTACTTGACGTGACAGAGGCCGTCCGACAAGGCGCCGCGCCA
GACTTTCACGGCGCCATCATCCCGACCGACAACTTCCGAAGGCTCCTTATGCTACTACTTCTCGCCGCGCCATTG
AGCCCCCAAGAGTGCCTCTCCCAGTTTTCGAGCGGCGTGGCGGGCGACCAGCTCGAGCAGCTGCGGTCGACGTCC
GAGCATATGCTTGCCTCGTTTGTCGACGCCGAAACGTCTCCCGGAGTCAAGTACAGGCACTTCAAGGCCGTTCTC
CCCGTCCTCTTCCCCAACCTCTTCTGCGGCTTCAACGGCCTTTTCGAGCGCCTTCTCTTTTCCAAGAACCTCGAC
TTTTCGCGGCACGGGAACGAGGCGAGACCGCCGGCCGCCGCGCAGCCGTTGCTGTCCGACGTGGGCGAGATTCTC
AACGACCACGTGCTGTCGCAAATCTCCATGTTCCTCCCCGGATCCTCCCTGTTCCGGAGAGTGCGGCTGCTGTAC
TCGGGAAGTAGTGCCGGTTTCTCGATGGGCAGCTTCGAGTCAACAGTCTTTCACTGGCGGGCACCCACGCTACTG
TTGGTGAGCGGGACCCGGCTGGGCGACGTGCCGGACGGCGGGCAGGAGGCGGCCTTTGCCGAGTCGCTGCCGACG
AAGCGCTTTCCTCCCGGCAGCAAGTCCGGCCGGGTCACGTACGGGGTCTACGTGCGGGAGCCCTGGAAGCACACC
AGCCGGGGCTGCTTCGGCGACTCGGAGACGGTCCTCTTTCAGCTCGAGCCCATCCACGATGTCTTTCCCGCCTCG
ACCATGAACACCGACTACGTCGCCTTCACCAAGTCGTCCGGCAACCAGCAGTGCCTGTCGTTCGGCTGCCCGCAC
CCGAGGCAGACGCAGTCGCAACGCAGAGACGGCTCCTTTGCCCTGGGATCCGTGTCCCTGCTGCTCAACGACTCC
TTCGAGTTTGGCGTCTTCAACCACGACTACAGGTCCCGCGGCGGGGCCTTCCACACGAGCCTGACGAGGAAGCTG
GACTTCCAGGACCGCTTCCAGATCGAGAAGCTCGAGGTCTGGGGCTGCGGGGGGGACGCCGAGGCAAAGGCTCAG
GCCGAGCGGTGGGCGTGGGAGGAGAGGGAGGCGGAGGCGCGGCGGAAGATCAACCTCGGGACGGGAGATATTGCC
GCGGACAGGGCGTTGCTGGAGATGGCCGGTCTCGTCGGCGCGAACCGCAGCGGAGGATCCATGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail