Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|40
Gene name
LocationContig_1000:5353..6579
Strand+
Gene length (bp)1226
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5753 0.2823 0.2245 0.0726 0.4413 0.2291 0.1049 0.226 0.2867 0.1035

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2619
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7544
Ophiocordyceps australis map64 (Brazil) OphauB2|3060
Ophiocordyceps camponoti-floridani Ophcf2|00880
Ophiocordyceps camponoti-rufipedis Ophun1|5681
Ophiocordyceps kimflemingae Ophio5|4285
Ophiocordyceps subramaniannii Hirsu2|40 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|40
MSRPGRAPSCVGNPSFRPVDAVSDAALRQRVLESLSRDHVAEASRILLGLPADDAYTYHAVASVRLDQVQAVVDM
GRANGLHTWYRDDHGSPREPPPQPDTEAYIAIFSPSTATASALRNLGTNAKKGSIRAEVAGHLGQKRYVHAALLS
RLTVPRSKSPPCQNPSLDFWAWSCRSLEWCGPCASSERVATSHHVLPVLMHHFGCATPTHESLEVLRTLADGRAV
ADIGAGNGYWSFLLRRYGLTVHAVDNMQSEWRVNWVGDTVIMDGVQWLRRNAGGSDMVLLLVYPVVGGGVGGGVD
GAFTRGLVDAFQGDTLAVVGTQNGNGYTGFRSMTMDRYMADEKPEWTRVVQIALPSFAGKDEALFVYQRGDRAPP
ADKAS*
Coding >Hirsu2|40
ATGTCTCGCCCCGGCCGAGCCCCCAGCTGCGTGGGCAATCCCTCGTTCCGGCCCGTCGACGCCGTCAGCGACGCG
GCGCTGCGGCAGCGCGTGCTCGAGTCGCTGTCTAGGGACCATGTGGCCGAGGCCAGCCGCATCCTGCTCGGCCTC
CCGGCCGACGACGCCTACACCTACCACGCCGTCGCCAGCGTCAGGCTGGACCAGGTGCAGGCCGTCGTGGACATG
GGCCGCGCCAACGGGCTGCACACATGGTATCGCGACGACCATGGTTCTCCTAGGGAGCCCCCGCCTCAGCCCGAC
ACCGAGGCCTACATCGCCATCTTCAGCCCGTCGACGGCGACGGCCTCGGCCCTCCGGAACCTGGGCACCAATGCC
AAGAAGGGCTCCATCCGCGCCGAGGTGGCCGGCCACCTGGGCCAGAAGCGCTACGTCCACGCCGCCCTGCTGTCG
CGGCTGACGGTGCCCAGGTCCAAGTCGCCGCCCTGCCAGAACCCGTCGCTCGACTTCTGGGCCTGGTCGTGTCGG
AGCCTCGAGTGGTGCGGTCCCTGCGCCTCGTCGGAGCGGGTGGCCACCAGCCACCACGTCCTGCCCGTCCTCATG
CACCACTTCGGCTGCGCGACGCCGACCCACGAGAGCCTTGAGGTGCTCCGGACGCTGGCGGACGGGCGGGCCGTG
GCCGATATCGGCGCCGGCAACGGCTACTGGTCCTTTCTGCTGCGCCGCTACGGCCTGACCGTGCACGCCGTCGAC
AACATGCAGAGCGAGTGGAGGGTCAACTGGGTGGGCGACACCGTCATCATGGACGGCGTCCAGTGGCTGCGCAGG
AACGCCGGCGGCAGCGACATGGTGCTGCTGCTGGTCTACCCCGTCGTCGGCGGCGGCGTCGGCGGCGGCGTCGAC
GGCGCCTTCACCCGCGGTCTCGTCGACGCCTTCCAGGGCGACACGCTCGCCGTCGTCGGCACCCAGAACGGCAAC
GGCTACACGGGCTTCCGAAGCATGACCATGGACCGGTACATGGCCGACGAGAAGCCGGAGTGGACGAGGGTGGTG
CAGATTGCGCTGCCGAGCTTCGCGGGAAAAGACGAGGCTCTCTTCGTCTACCAACGAGGCGACCGAGCTCCGCCG
GCAGATAAGGCCTCGTGA
Transcript >Hirsu2|40
ATGTCTCGCCCCGGCCGAGCCCCCAGCTGCGTGGGCAATCCCTCGTTCCGGCCCGTCGACGCCGTCAGCGACGCG
GCGCTGCGGCAGCGCGTGCTCGAGTCGCTGTCTAGGGACCATGTGGCCGAGGCCAGCCGCATCCTGCTCGGCCTC
CCGGCCGACGACGCCTACACCTACCACGCCGTCGCCAGCGTCAGGCTGGACCAGGTGCAGGCCGTCGTGGACATG
GGCCGCGCCAACGGGCTGCACACATGGTATCGCGACGACCATGGTTCTCCTAGGGAGCCCCCGCCTCAGCCCGAC
ACCGAGGCCTACATCGCCATCTTCAGCCCGTCGACGGCGACGGCCTCGGCCCTCCGGAACCTGGGCACCAATGCC
AAGAAGGGCTCCATCCGCGCCGAGGTGGCCGGCCACCTGGGCCAGAAGCGCTACGTCCACGCCGCCCTGCTGTCG
CGGCTGACGGTGCCCAGGTCCAAGTCGCCGCCCTGCCAGAACCCGTCGCTCGACTTCTGGGCCTGGTCGTGTCGG
AGCCTCGAGTGGTGCGGTCCCTGCGCCTCGTCGGAGCGGGTGGCCACCAGCCACCACGTCCTGCCCGTCCTCATG
CACCACTTCGGCTGCGCGACGCCGACCCACGAGAGCCTTGAGGTGCTCCGGACGCTGGCGGACGGGCGGGCCGTG
GCCGATATCGGCGCCGGCAACGGCTACTGGTCCTTTCTGCTGCGCCGCTACGGCCTGACCGTGCACGCCGTCGAC
AACATGCAGAGCGAGTGGAGGGTCAACTGGGTGGGCGACACCGTCATCATGGACGGCGTCCAGTGGCTGCGCAGG
AACGCCGGCGGCAGCGACATGGTGCTGCTGCTGGTCTACCCCGTCGTCGGCGGCGGCGTCGGCGGCGGCGTCGAC
GGCGCCTTCACCCGCGGTCTCGTCGACGCCTTCCAGGGCGACACGCTCGCCGTCGTCGGCACCCAGAACGGCAAC
GGCTACACGGGCTTCCGAAGCATGACCATGGACCGGTACATGGCCGACGAGAAGCCGGAGTGGACGAGGGTGGTG
CAGATTGCGCTGCCGAGCTTCGCGGGAAAAGACGAGGCTCTCTTCGTCTACCAACGAGGCGACCGAGCTCCGCCG
GCAGATAAGGCCTCGTGA
Gene >Hirsu2|40
ATGTCTCGCCCCGGCCGAGCCCCCAGCTGCGTGGGCAATCCCTCGTTCCGGCCCGTCGACGCCGTCAGCGACGCG
GCGCTGCGGCAGCGCGTGCTCGAGTCGCTGTCTAGGGACCATGTGGCCGAGGCCAGCCGCATCCTGCTCGGCCTC
CCGGCCGACGACGCCTACACCTACCACGCCGTCGCCAGCGTCAGGCTGGACCAGGTGCAGGCCGTCGTGGACATG
GGCCGCGCCAACGGGCTGCACACATGGTATCGCGACGACCATGGTTCTCCTGTACGTGCCAAACGCGGCTGACGT
TGCGGCTCGAGGCTGACGACGGGTGCCCGCCGCCCCTTGCGCCCCTCCCTGGTCGGCAGAGGGAGCCCCCGCCTC
AGCCCGACACCGAGGCCTACATCGCCATCTTCAGCCCGTCGACGGCGACGGCCTCGGCCCTCCGGAACCTGGGCA
CCAATGCCAAGAAGGGCTCCATCCGCGCCGAGGTGGCCGGCCACCTGGGCCAGAAGCGCTACGTCCACGCCGCCC
TGCTGTCGCGGCTGACGGTGCCCAGGTCCAAGTCGCCGCCCTGCCAGAACCCGTCGCTCGACTTCTGGGCCTGGT
CGTGTCGGAGCCTCGAGTGGTGCGGTCCCTGCGCCTCGTCGGAGCGGGTGGCCACCAGCCACCACGTCCTGCCCG
TCCTCATGCACCACTTCGGCTGCGCGACGCCGACCCACGAGAGCCTTGAGGTGCTCCGGACGCTGGCGGACGGGC
GGGCCGTGGCCGATATCGGCGCCGGCAACGGCTACTGGTCCTTTCTGCTGCGCCGCTACGGCCTGACCGTGCACG
CCGTCGACAACATGCAGAGCGAGTGGAGGGTCAACTGGGTGGGCGACACCGTCATCATGGACGGCGTCCAGTGGC
TGCGCAGGAACGCCGGCGGCAGCGACATGGTGCTGCTGCTGGTCTACCCCGTCGTCGGCGGCGGCGTCGGCGGCG
GCGTCGACGGCGCCTTCACCCGCGGTCTCGTCGACGCCTTCCAGGGCGACACGCTCGCCGTCGTCGGCACCCAGA
ACGGCAACGGCTACACGGGCTTCCGAAGCATGACCATGGACCGGTACATGGCCGACGAGAAGCCGGAGTGGACGA
GGGTGGTGCAGATTGCGCTGCCGAGCTTCGCGGGAAAAGACGAGGCTCTCTTCGTCTACCAACGAGGCGACCGAG
CTCCGCCGGCAGATAAGGCCTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail