Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3987
Gene name
LocationContig_2081:224..2122
Strand+
Gene length (bp)1898
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01424 R3H R3H domain 1.4E-11 419 472
PF01585 G-patch G-patch domain 8.9E-06 536 578

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q875B6|SQS1_PODAS Protein SQS1 OS=Podospora anserina GN=SQS1 PE=3 SV=1 364 578 1.0E-49
sp|Q6BYP9|SQS1_DEBHA Protein SQS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SQS1 PE=3 SV=2 380 578 1.0E-26
sp|Q6FP19|SQS1_CANGA Protein SQS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SQS1 PE=3 SV=1 379 578 4.0E-26
sp|A7TQN2|SQS1_VANPO Protein SQS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SQS1 PE=3 SV=1 362 578 8.0E-23
sp|P53866|SQS1_YEAST Protein SQS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SQS1 PE=1 SV=1 380 578 8.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q875B6|SQS1_PODAS Protein SQS1 OS=Podospora anserina GN=SQS1 PE=3 SV=1 364 578 1.0E-49
sp|Q6BYP9|SQS1_DEBHA Protein SQS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SQS1 PE=3 SV=2 380 578 1.0E-26
sp|Q6FP19|SQS1_CANGA Protein SQS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SQS1 PE=3 SV=1 379 578 4.0E-26
sp|A7TQN2|SQS1_VANPO Protein SQS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SQS1 PE=3 SV=1 362 578 8.0E-23
sp|P53866|SQS1_YEAST Protein SQS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SQS1 PE=1 SV=1 380 578 8.0E-23
sp|A6ZRL6|SQS1_YEAS7 Protein SQS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SQS1 PE=3 SV=1 364 578 9.0E-23
sp|A5DEF8|SQS1_PICGU Protein SQS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SQS1 PE=3 SV=3 379 578 5.0E-22
sp|Q6CQ59|SQS1_KLULA Protein SQS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SQS1 PE=3 SV=1 378 578 6.0E-22
sp|Q59UG4|SQS1_CANAL Protein SQS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SQS1 PE=3 SV=1 378 578 6.0E-21
sp|Q75E62|SQS1_ASHGO Protein SQS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SQS1 PE=3 SV=1 404 578 3.0E-20
sp|O74363|YND2_SCHPO G-patch and R3H domain-containing protein C30B4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC30B4.02c PE=3 SV=1 417 578 5.0E-18
sp|A5DSB5|SQS1_LODEL Protein SQS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SQS1 PE=3 SV=1 404 578 8.0E-16
sp|Q6C233|SQS1_YARLI Protein SQS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SQS1 PE=3 SV=1 380 578 2.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3987
MRPSFGDSAVDKFDGLNLTGGFRRTGQPDYDPRDRDSRLRNKPVPFLSAGPSNPFENPTADKHRHRLGKEQQRSC
PSAQKHITESLKRVLNSHRAALVEPAVCGPDFPNLSKHCFDQASSEVPKAVPTRPPSRDSSSCDEVILFRGRKPG
TLKTLSSTGDPHEPVDLVMPRKQASAPSPPEYINVHLAPARKARNSRRDGGRLKSNKYENMGLDDYVANLRENGE
LNASTYEPPCPTNKHNHSSDDLLLDANTTEPRDHFGELKIRHEHEFDGFIVSDTDSIGVGSLVLQCHIEEDEEES
ECRAYHSEQDLFGIDCQLRGVNHEADRTSGYEGSDLTNSERHASRQKSLGKKSHPPASAGFVFKCEPRLETATRF
DGLKKNQRKKQREELRALGLLGQKSDPQDLKFKYPTGMSTVDVTEEFKWFLTLRKETLSFPPMDHHARKLIHELA
NQFKVTSKSTGTAKQRRPTLYRTKRTLPYDETYFEQILTRIRRRFLPRTDVKGKNTLHRKGAHQHYKTASYQDGD
IIGAAAPELGTENRGRALLEKLGWCSGTALGAAHNKGILQPVSHIMKRSKTGLC*
Coding >Hirsu2|3987
ATGCGTCCTTCATTCGGCGATTCCGCAGTTGACAAATTTGATGGATTGAACCTGACCGGGGGATTTCGAAGGACA
GGGCAGCCAGACTACGATCCTCGGGATAGGGACTCAAGATTACGCAATAAGCCAGTTCCATTTTTGAGTGCTGGC
CCAAGTAATCCGTTTGAAAACCCGACTGCGGACAAACATCGACACCGACTGGGTAAGGAGCAGCAACGCAGCTGC
CCGTCAGCACAGAAACATATCACCGAGAGTTTGAAAAGGGTTCTGAATTCGCATCGGGCTGCCTTGGTCGAACCC
GCCGTTTGCGGGCCCGATTTCCCCAACCTGTCCAAGCATTGCTTCGATCAAGCGTCGAGCGAGGTGCCCAAAGCT
GTTCCAACGCGGCCCCCATCTCGAGATAGCAGCTCTTGCGACGAGGTCATACTATTTCGCGGCCGTAAGCCAGGC
ACACTGAAAACCCTTTCGTCTACAGGTGATCCCCATGAGCCTGTAGACTTGGTCATGCCACGAAAACAAGCATCG
GCGCCAAGTCCACCAGAGTACATAAATGTTCATCTCGCACCCGCGAGAAAGGCTCGAAACTCCAGACGGGATGGC
GGCCGATTGAAGAGCAACAAATATGAAAACATGGGTTTGGACGACTATGTAGCCAACCTGCGAGAAAATGGGGAA
CTGAACGCATCTACGTATGAGCCACCATGCCCCACAAATAAGCATAATCATTCTAGTGACGATCTGTTACTGGAT
GCCAACACTACAGAACCACGGGACCATTTCGGGGAATTGAAAATTCGGCACGAACACGAATTCGACGGTTTTATC
GTGTCCGATACGGACAGCATCGGCGTCGGCTCTCTTGTGCTACAATGCCACATCGAAGAAGATGAAGAAGAGTCC
GAATGTAGAGCCTATCACAGCGAGCAAGATTTATTCGGCATTGACTGTCAGTTGCGTGGAGTCAATCACGAAGCG
GACAGAACCTCTGGATACGAAGGATCTGATTTGACGAACAGTGAACGACATGCATCCCGTCAAAAGAGCTTAGGG
AAGAAGTCTCACCCGCCGGCTTCGGCTGGGTTTGTTTTTAAGTGCGAGCCGCGACTGGAAACTGCCACGAGGTTT
GATGGACTCAAGAAAAACCAGCGGAAGAAGCAGCGTGAAGAACTGCGAGCACTTGGCTTACTCGGACAAAAATCC
GACCCCCAGGATCTTAAATTTAAGTATCCCACCGGCATGAGCACAGTCGATGTCACTGAGGAATTCAAGTGGTTC
CTTACGCTCAGGAAAGAAACCTTGTCATTCCCGCCCATGGACCATCATGCGAGGAAACTTATCCACGAACTCGCC
AATCAGTTCAAAGTTACGTCAAAGTCGACTGGCACGGCCAAGCAGCGTCGACCCACGCTATACAGAACCAAGAGA
ACTTTACCTTACGACGAGACATATTTTGAACAAATTTTGACGCGCATCCGCCGTCGTTTCCTCCCACGGACGGAT
GTCAAGGGGAAGAACACACTTCACAGGAAAGGAGCACACCAGCACTATAAGACGGCCAGCTACCAGGACGGAGAT
ATTATCGGTGCTGCGGCGCCTGAATTGGGGACCGAGAATCGCGGTCGAGCGTTGTTGGAGAAGTTGGGTTGGTGT
AGCGGAACGGCATTGGGGGCCGCGCATAACAAGGGTATCTTGCAGCCTGTATCGCACATCATGAAGCGAAGCAAG
ACAGGCCTGTGCTAG
Transcript >Hirsu2|3987
ATGCGTCCTTCATTCGGCGATTCCGCAGTTGACAAATTTGATGGATTGAACCTGACCGGGGGATTTCGAAGGACA
GGGCAGCCAGACTACGATCCTCGGGATAGGGACTCAAGATTACGCAATAAGCCAGTTCCATTTTTGAGTGCTGGC
CCAAGTAATCCGTTTGAAAACCCGACTGCGGACAAACATCGACACCGACTGGGTAAGGAGCAGCAACGCAGCTGC
CCGTCAGCACAGAAACATATCACCGAGAGTTTGAAAAGGGTTCTGAATTCGCATCGGGCTGCCTTGGTCGAACCC
GCCGTTTGCGGGCCCGATTTCCCCAACCTGTCCAAGCATTGCTTCGATCAAGCGTCGAGCGAGGTGCCCAAAGCT
GTTCCAACGCGGCCCCCATCTCGAGATAGCAGCTCTTGCGACGAGGTCATACTATTTCGCGGCCGTAAGCCAGGC
ACACTGAAAACCCTTTCGTCTACAGGTGATCCCCATGAGCCTGTAGACTTGGTCATGCCACGAAAACAAGCATCG
GCGCCAAGTCCACCAGAGTACATAAATGTTCATCTCGCACCCGCGAGAAAGGCTCGAAACTCCAGACGGGATGGC
GGCCGATTGAAGAGCAACAAATATGAAAACATGGGTTTGGACGACTATGTAGCCAACCTGCGAGAAAATGGGGAA
CTGAACGCATCTACGTATGAGCCACCATGCCCCACAAATAAGCATAATCATTCTAGTGACGATCTGTTACTGGAT
GCCAACACTACAGAACCACGGGACCATTTCGGGGAATTGAAAATTCGGCACGAACACGAATTCGACGGTTTTATC
GTGTCCGATACGGACAGCATCGGCGTCGGCTCTCTTGTGCTACAATGCCACATCGAAGAAGATGAAGAAGAGTCC
GAATGTAGAGCCTATCACAGCGAGCAAGATTTATTCGGCATTGACTGTCAGTTGCGTGGAGTCAATCACGAAGCG
GACAGAACCTCTGGATACGAAGGATCTGATTTGACGAACAGTGAACGACATGCATCCCGTCAAAAGAGCTTAGGG
AAGAAGTCTCACCCGCCGGCTTCGGCTGGGTTTGTTTTTAAGTGCGAGCCGCGACTGGAAACTGCCACGAGGTTT
GATGGACTCAAGAAAAACCAGCGGAAGAAGCAGCGTGAAGAACTGCGAGCACTTGGCTTACTCGGACAAAAATCC
GACCCCCAGGATCTTAAATTTAAGTATCCCACCGGCATGAGCACAGTCGATGTCACTGAGGAATTCAAGTGGTTC
CTTACGCTCAGGAAAGAAACCTTGTCATTCCCGCCCATGGACCATCATGCGAGGAAACTTATCCACGAACTCGCC
AATCAGTTCAAAGTTACGTCAAAGTCGACTGGCACGGCCAAGCAGCGTCGACCCACGCTATACAGAACCAAGAGA
ACTTTACCTTACGACGAGACATATTTTGAACAAATTTTGACGCGCATCCGCCGTCGTTTCCTCCCACGGACGGAT
GTCAAGGGGAAGAACACACTTCACAGGAAAGGAGCACACCAGCACTATAAGACGGCCAGCTACCAGGACGGAGAT
ATTATCGGTGCTGCGGCGCCTGAATTGGGGACCGAGAATCGCGGTCGAGCGTTGTTGGAGAAGTTGGGTTGGTGT
AGCGGAACGGCATTGGGGGCCGCGCATAACAAGGGTATCTTGCAGCCTGTATCGCACATCATGAAGCGAAGCAAG
ACAGGCCTGTGCTAG
Gene >Hirsu2|3987
ATGCGTCCTTCATTCGGCGATTCCGCAGTTGACAAATTTGGTGAAACCTCCCTCTTTTATGTCAGGAAATGGATC
AAAAAGAAAAGGCGGGCTGACCAATGATACAATATGCGTACTTTAGATGGATTGAACCTGACCGGGGGATTTCGA
AGGACAGGGCAGCCAGACTACGATCCTCGGGATAGGGACTCAAGATTACGCAATAAGCCAGTTCCATTTTTGAGT
GCTGGCCCAAGTAATCCGTTTGAAAACCCGACTGCGGACAAACATCGACACCGACTGGGTAAGGAGCAGCAACGC
AGCTGCCCGTCAGCACAGAAACATATCACCGAGAGTTTGAAAAGGGTTCTGAATTCGCATCGGGCTGCCTTGGTC
GAACCCGCCGTTTGCGGGCCCGATTTCCCCAACCTGTCCAAGCATTGCTTCGATCAAGCGTCGAGCGAGGTGCCC
AAAGCTGTTCCAACGCGGCCCCCATCTCGAGATAGCAGCTCTTGCGACGAGGTCATACTATTTCGCGGCCGTAAG
CCAGGCACACTGAAAACCCTTTCGTCTACAGGTGATCCCCATGAGCCTGTAGACTTGGTCATGCCACGAAAACAA
GCATCGGCGCCAAGTCCACCAGAGTACATAAATGTTCATCTCGCACCCGCGAGAAAGGCTCGAAACTCCAGACGG
GATGGCGGCCGATTGAAGAGCAACAAATATGAAAACATGGGTTTGGACGACTATGTAGCCAACCTGCGAGAAAAT
GGGGAACTGAACGCATCTACGTATGAGCCACCATGCCCCACAAATAAGCATAATCATTCTAGTGACGATCTGTTA
CTGGATGCCAACACTACAGAACCACGGGACCATTTCGGGGAATTGAAAATTCGGCACGAACACGAATTCGACGGT
TTTATCGTGTCCGATACGGACAGCATCGGCGTCGGCTCTCTTGTGCTACAATGCCACATCGAAGAAGATGAAGAA
GAGTCCGAATGTAGAGCCTATCACAGCGAGCAAGATTTATTCGGCATTGACTGTCAGTTGCGTGGAGTCAATCAC
GAAGCGGACAGAACCTCTGGATACGAAGGATCTGATTTGACGAACAGTGAACGACATGCATCCCGTCAAAAGAGC
TTAGGGAAGAAGTCTCACCCGCCGGCTTCGGCTGGGTTTGTTTTTAAGTGCGAGCCGCGACTGGAAACTGCCACG
AGGTTTGATGGACTCAAGAAAAACCAGCGGAAGAAGCAGCGTGAAGAACTGCGAGCACTTGGCTTACTCGGACAA
AAATCCGACCCCCAGGATCTTAAATTTAAGTATCCCACCGGCATGAGCACAGTCGATGTCACTGAGGAATTCAAG
TGGTTCCTTACGCTCAGGAAAGAAACGTAAGGCTCTTGTTATGACATCTTTATCTAAGATACATCTTTGTGGCCT
TTCCTTCACTGACTCACCTCATATCTAGCTTGTCATTCCCGCCCATGGACCATCATGCGAGGAAACTTATCCACG
AACTCGCCAATCAGTTCAAAGTTACGTCAAAGTCGACTGGCACGGCCAAGCAGCGTCGACCCACGCTATACAGAA
CCAAGAGAACTTTACCTTACGACGAGACATATTTTGAACAAATTTTGACGCGCATCCGCCGTCGTTTCCTCCCAC
GGACGGATGTCAAGGGGAAGAACACACTTCACAGGAAAGGAGCACACCAGCACTATAAGACGGCCAGCTACCAGG
ACGGAGATATTATCGGTGCTGCGGCGCCTGAATTGGGGACCGAGAATCGCGGTCGAGCGTTGTTGGAGAAGTTGG
GTTGGTGTAGCGGAACGGCATTGGGGGCCGCGCATAACAAGGGTATCTTGCAGCCTGTATCGCACATCATGAAGC
GAAGCAAGACAGGCCTGTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail