Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|398
Gene name
LocationContig_1079:195..2465
Strand-
Gene length (bp)2270
Transcript length (bp)2205
Coding sequence length (bp)2205
Protein length (aa) 735

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 3.0E-07 290 348
PF00569 ZZ Zinc finger, ZZ type 2.2E-09 146 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 262 367 1.0E-09
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 262 367 3.0E-09
sp|Q91614|NCS1_XENLA Neuronal calcium sensor 1 OS=Xenopus laevis GN=ncs1 PE=2 SV=2 221 351 5.0E-09
sp|Q5RC90|NCS1_PONAB Neuronal calcium sensor 1 OS=Pongo abelii GN=NCS1 PE=2 SV=3 221 351 6.0E-09
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 221 351 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 262 367 1.0E-09
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 262 367 3.0E-09
sp|Q91614|NCS1_XENLA Neuronal calcium sensor 1 OS=Xenopus laevis GN=ncs1 PE=2 SV=2 221 351 5.0E-09
sp|Q5RC90|NCS1_PONAB Neuronal calcium sensor 1 OS=Pongo abelii GN=NCS1 PE=2 SV=3 221 351 6.0E-09
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 221 351 7.0E-09
sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=1 SV=3 221 351 7.0E-09
sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 221 351 7.0E-09
sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 221 351 7.0E-09
sp|P37236|FREQ_DROME Frequenin-1 OS=Drosophila melanogaster GN=Frq1 PE=2 SV=2 221 356 7.0E-09
sp|Q24629|REF2P_DROSI Protein ref(2)P OS=Drosophila simulans GN=ref(2)P PE=3 SV=1 142 193 2.0E-08
sp|Q3YLA4|NCS1_LYMST Neuronal calcium sensor 1 OS=Lymnaea stagnalis PE=2 SV=2 286 351 3.0E-08
sp|Q32L26|EFCB1_BOVIN EF-hand calcium-binding domain-containing protein 1 OS=Bos taurus GN=EFCAB1 PE=2 SV=1 262 367 4.0E-08
sp|Q7FRS8|CNBLA_ARATH Calcineurin B-like protein 10 OS=Arabidopsis thaliana GN=CBL10 PE=1 SV=1 217 371 5.0E-08
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 145 197 5.0E-08
sp|Q2V8Y7|NCS1_BOVIN Neuronal calcium sensor 1 OS=Bos taurus GN=NCS1 PE=1 SV=3 221 351 9.0E-08
sp|Q16981|NCS1_APLCA Neuronal calcium sensor 1 OS=Aplysia californica PE=2 SV=2 286 351 1.0E-07
sp|Q3KQ77|EFCB1_XENLA EF-hand calcium-binding domain-containing protein 1 OS=Xenopus laevis GN=efcab1 PE=2 SV=1 265 367 2.0E-07
sp|P14199|REF2P_DROME Protein ref(2)P OS=Drosophila melanogaster GN=ref(2)P PE=1 SV=2 142 193 3.0E-07
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 145 197 4.0E-07
sp|Q16982|NECX_APLCA Neurocalcin OS=Aplysia californica PE=2 SV=2 221 359 6.0E-07
sp|Q06389|NCS1_YEAST Calcium-binding protein NCS-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRQ1 PE=1 SV=2 229 357 6.0E-07
sp|P36608|NCS1_CAEEL Neuronal calcium sensor 1 OS=Caenorhabditis elegans GN=ncs-1 PE=2 SV=2 221 351 8.0E-07
sp|Q75K28|NCSA_DICDI Calcium-binding protein NCSA OS=Dictyostelium discoideum GN=ncsA PE=1 SV=2 220 353 9.0E-07
sp|Q09711|NCS1_SCHPO Calcium-binding protein NCS-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncs1 PE=1 SV=2 221 359 1.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 143 197 2.0E-06
sp|Q86A72|Y4781_DICDI Recoverin family protein DDB_G0274781 OS=Dictyostelium discoideum GN=DDB_G0274781 PE=3 SV=1 225 352 2.0E-06
sp|P84076|HPCA_RAT Neuron-specific calcium-binding protein hippocalcin OS=Rattus norvegicus GN=Hpca PE=1 SV=2 225 359 3.0E-06
sp|Q06AT1|HPCA_PIG Neuron-specific calcium-binding protein hippocalcin OS=Sus scrofa GN=HPCA PE=2 SV=3 225 359 3.0E-06
sp|P84075|HPCA_MOUSE Neuron-specific calcium-binding protein hippocalcin OS=Mus musculus GN=Hpca PE=1 SV=2 225 359 3.0E-06
sp|P84074|HPCA_HUMAN Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens GN=HPCA PE=1 SV=2 225 359 3.0E-06
sp|Q4PL64|HPCA_BOVIN Neuron-specific calcium-binding protein hippocalcin OS=Bos taurus GN=HPCA PE=2 SV=3 225 359 3.0E-06
sp|P42325|NCAH_DROME Neurocalcin homolog OS=Drosophila melanogaster GN=Nca PE=1 SV=2 221 359 3.0E-06
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 143 205 3.0E-06
sp|Q6DCM9|HPCL1_XENLA Hippocalcin-like protein 1 OS=Xenopus laevis GN=hpcal1 PE=2 SV=1 225 359 4.0E-06
sp|Q28IM6|HPCL1_XENTR Hippocalcin-like protein 1 OS=Xenopus tropicalis GN=hpcal1 PE=2 SV=1 229 359 5.0E-06
sp|B3VSB7|HPCL1_SHEEP Hippocalcin-like protein 1 OS=Ovis aries GN=HPCAL1 PE=2 SV=1 229 359 6.0E-06
sp|Q06AT0|HPCL1_PIG Hippocalcin-like protein 1 OS=Sus scrofa GN=HPCAL1 PE=2 SV=3 229 359 6.0E-06
sp|P29105|HPCL1_BOVIN Hippocalcin-like protein 1 OS=Bos taurus GN=HPCAL1 PE=1 SV=4 229 359 6.0E-06
sp|B5FZ84|HPCL1_TAEGU Hippocalcin-like protein 1 OS=Taeniopygia guttata GN=HPCAL1 PE=2 SV=1 229 359 6.0E-06
sp|P42324|HPCL1_CHICK Hippocalcin-like protein 1 OS=Gallus gallus GN=HPCAL1 PE=1 SV=2 229 359 6.0E-06
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 143 197 7.0E-06
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 143 197 8.0E-06
sp|P37235|HPCL1_HUMAN Hippocalcin-like protein 1 OS=Homo sapiens GN=HPCAL1 PE=1 SV=3 229 359 8.0E-06
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 143 197 8.0E-06
sp|P62749|HPCL1_RAT Hippocalcin-like protein 1 OS=Rattus norvegicus GN=Hpcal1 PE=1 SV=2 291 359 9.0E-06
sp|P62748|HPCL1_MOUSE Hippocalcin-like protein 1 OS=Mus musculus GN=Hpcal1 PE=1 SV=2 291 359 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|398
MWPSSSSAETLTRPRVAVALVSAAAAAASIGYYAYQAGWPSSLYHRSRAGSLHRSNAVRRTRHSRAARNDAGSSS
ESEAAGDENVEVINDAAAARPADAETVVEVDAGEWWNDPSGFQPPQRAGHNIVSLLFRVSEDNARRNGCVHRGCQ
CNACGMVPIRGIRYRCANCADFDLCETCEAQGVHIKTHIFYKIRVPAPPFGPRQMQPVWYTGDPDVCRRSLPRSL
IARLSRDTGFERPELEAFWEQWTFMAFSELRDDPDELLVAMDRKTFERCLVPTGGSRHATPNLIHDRMFAFYDSN
NDGLISFAEFLHGLSYRKRKDKLRKVFEGYDIDNDGYVNRRDFLRMFRAYYVLYKQMHKDILDGLEDQLLTSGEA
IAVVHSRQPLSSLFGREGRVPPADGNMRFDGKTYHRDGTIDVDDAHQRATVENHGDTASREDILTSLFAYDTYQR
PRRRFVARRDTDTNWRTVRRLSGTETDRAYWVTLLDPPATLDEIPGVLDGSNNPGVEESDDDEADDDRADRDGRG
DEHDGDGSEQPPQRDPDAVAAGTPRTDSERLARMLSSARRKAPKLEKQRRDMARSQLHERWRRRQFYLDEEEGGL
APDDWDNDEDILAKLSKAVEDAQSGGDQHNAAPTRSRSSSKVRFAEDMDDHDTRSNPSTSSRSIPERWGGMGIPD
AEKDAGREILYQVTQQAFNELLDTIFKPAEDLAVEAATTKAQRERYRAEIESFRKGRPG*
Coding >Hirsu2|398
ATGTGGCCATCGAGTTCCTCGGCCGAGACGCTGACGCGCCCGCGCGTGGCCGTGGCCCTCGTCTCGGCCGCCGCC
GCCGCCGCCTCCATTGGCTACTACGCCTACCAGGCCGGCTGGCCTTCATCGCTCTACCACCGTTCCCGCGCCGGC
AGCCTGCACCGGAGCAACGCCGTGCGACGCACGCGCCACAGCCGCGCCGCCAGAAACGACGCCGGCTCGAGCTCC
GAGTCCGAGGCCGCCGGGGACGAAAATGTCGAGGTCATCAACGACGCGGCCGCGGCCCGGCCCGCCGACGCCGAG
ACGGTCGTCGAGGTCGACGCCGGCGAGTGGTGGAACGACCCGTCGGGCTTCCAGCCGCCCCAGCGCGCCGGACAC
AACATCGTGAGCCTGCTGTTCCGCGTGTCCGAGGACAACGCCCGGCGGAACGGCTGCGTCCATCGAGGATGCCAG
TGTAATGCATGTGGCATGGTGCCCATCCGCGGCATCCGCTACCGCTGCGCCAACTGCGCCGACTTCGACCTGTGC
GAGACGTGCGAGGCCCAGGGCGTCCACATCAAGACGCACATCTTCTACAAGATCAGGGTCCCGGCCCCTCCCTTC
GGCCCCCGCCAGATGCAGCCCGTCTGGTACACGGGCGACCCGGACGTCTGCCGCCGCAGCCTGCCGCGCTCCCTG
ATCGCCCGCCTGTCGCGCGACACCGGCTTCGAGCGGCCCGAGCTCGAGGCCTTCTGGGAGCAGTGGACCTTCATG
GCCTTCTCCGAGCTGCGCGACGACCCGGACGAGCTGCTCGTCGCCATGGACCGCAAGACGTTCGAGCGATGCCTC
GTGCCCACCGGCGGCTCGCGCCACGCCACCCCCAACCTCATCCACGACCGCATGTTCGCCTTCTACGACTCCAAC
AACGACGGCCTCATCAGCTTCGCCGAGTTCCTGCACGGCCTCTCCTACCGGAAGCGCAAGGACAAGCTGCGTAAG
GTCTTCGAGGGCTACGACATCGACAACGACGGCTACGTCAACCGCCGCGACTTCCTCCGCATGTTTCGCGCCTAC
TACGTCCTCTACAAGCAGATGCACAAGGACATCCTCGACGGGCTCGAGGACCAGCTCCTCACCAGCGGCGAGGCC
ATCGCCGTCGTCCATAGCCGCCAGCCGCTCAGCAGCCTCTTCGGCCGCGAGGGCAGGGTCCCTCCCGCCGACGGC
AACATGCGCTTCGACGGCAAGACCTACCACCGGGACGGCACCATCGACGTCGACGACGCCCACCAGAGGGCGACC
GTCGAGAACCACGGAGACACGGCGAGCCGCGAGGACATTCTGACGAGCCTGTTCGCCTACGACACGTACCAACGG
CCCCGCCGCCGCTTCGTCGCCCGGAGAGACACCGACACCAACTGGCGCACCGTCCGCCGCCTGAGCGGCACCGAG
ACGGACCGCGCCTACTGGGTCACTCTCCTCGACCCGCCCGCCACGCTGGACGAGATCCCCGGCGTGCTCGACGGC
AGCAACAACCCGGGGGTCGAGGAGAGCGACGACGACGAGGCCGACGACGACCGAGCCGACCGGGACGGCCGGGGC
GACGAGCACGACGGCGACGGCAGCGAGCAACCCCCCCAGCGCGACCCGGACGCCGTCGCCGCCGGCACCCCTAGA
ACCGACAGCGAGCGTCTGGCCAGGATGCTCTCCAGCGCCCGCCGCAAGGCGCCCAAGCTGGAGAAGCAGCGCCGC
GACATGGCGCGGAGCCAGCTGCACGAGAGATGGAGGAGGCGCCAGTTCTATCTCGACGAGGAGGAGGGCGGCCTC
GCCCCGGACGACTGGGATAACGACGAGGACATACTCGCCAAGCTCAGCAAGGCCGTCGAAGACGCGCAGTCGGGC
GGCGACCAGCACAACGCCGCCCCCACCCGCTCGCGCTCCAGCTCCAAGGTCCGGTTCGCCGAGGACATGGACGAC
CATGACACGCGGTCCAACCCGTCGACGTCGTCGCGCAGCATCCCCGAGCGCTGGGGAGGCATGGGCATCCCGGAC
GCCGAGAAGGACGCCGGCCGAGAGATTCTCTACCAGGTGACGCAGCAGGCCTTCAACGAGCTGCTCGACACCATC
TTCAAGCCGGCCGAGGACCTGGCCGTCGAGGCGGCCACGACCAAGGCGCAGCGGGAGAGGTACAGGGCCGAGATC
GAGTCATTCCGAAAAGGCCGCCCAGGATAA
Transcript >Hirsu2|398
ATGTGGCCATCGAGTTCCTCGGCCGAGACGCTGACGCGCCCGCGCGTGGCCGTGGCCCTCGTCTCGGCCGCCGCC
GCCGCCGCCTCCATTGGCTACTACGCCTACCAGGCCGGCTGGCCTTCATCGCTCTACCACCGTTCCCGCGCCGGC
AGCCTGCACCGGAGCAACGCCGTGCGACGCACGCGCCACAGCCGCGCCGCCAGAAACGACGCCGGCTCGAGCTCC
GAGTCCGAGGCCGCCGGGGACGAAAATGTCGAGGTCATCAACGACGCGGCCGCGGCCCGGCCCGCCGACGCCGAG
ACGGTCGTCGAGGTCGACGCCGGCGAGTGGTGGAACGACCCGTCGGGCTTCCAGCCGCCCCAGCGCGCCGGACAC
AACATCGTGAGCCTGCTGTTCCGCGTGTCCGAGGACAACGCCCGGCGGAACGGCTGCGTCCATCGAGGATGCCAG
TGTAATGCATGTGGCATGGTGCCCATCCGCGGCATCCGCTACCGCTGCGCCAACTGCGCCGACTTCGACCTGTGC
GAGACGTGCGAGGCCCAGGGCGTCCACATCAAGACGCACATCTTCTACAAGATCAGGGTCCCGGCCCCTCCCTTC
GGCCCCCGCCAGATGCAGCCCGTCTGGTACACGGGCGACCCGGACGTCTGCCGCCGCAGCCTGCCGCGCTCCCTG
ATCGCCCGCCTGTCGCGCGACACCGGCTTCGAGCGGCCCGAGCTCGAGGCCTTCTGGGAGCAGTGGACCTTCATG
GCCTTCTCCGAGCTGCGCGACGACCCGGACGAGCTGCTCGTCGCCATGGACCGCAAGACGTTCGAGCGATGCCTC
GTGCCCACCGGCGGCTCGCGCCACGCCACCCCCAACCTCATCCACGACCGCATGTTCGCCTTCTACGACTCCAAC
AACGACGGCCTCATCAGCTTCGCCGAGTTCCTGCACGGCCTCTCCTACCGGAAGCGCAAGGACAAGCTGCGTAAG
GTCTTCGAGGGCTACGACATCGACAACGACGGCTACGTCAACCGCCGCGACTTCCTCCGCATGTTTCGCGCCTAC
TACGTCCTCTACAAGCAGATGCACAAGGACATCCTCGACGGGCTCGAGGACCAGCTCCTCACCAGCGGCGAGGCC
ATCGCCGTCGTCCATAGCCGCCAGCCGCTCAGCAGCCTCTTCGGCCGCGAGGGCAGGGTCCCTCCCGCCGACGGC
AACATGCGCTTCGACGGCAAGACCTACCACCGGGACGGCACCATCGACGTCGACGACGCCCACCAGAGGGCGACC
GTCGAGAACCACGGAGACACGGCGAGCCGCGAGGACATTCTGACGAGCCTGTTCGCCTACGACACGTACCAACGG
CCCCGCCGCCGCTTCGTCGCCCGGAGAGACACCGACACCAACTGGCGCACCGTCCGCCGCCTGAGCGGCACCGAG
ACGGACCGCGCCTACTGGGTCACTCTCCTCGACCCGCCCGCCACGCTGGACGAGATCCCCGGCGTGCTCGACGGC
AGCAACAACCCGGGGGTCGAGGAGAGCGACGACGACGAGGCCGACGACGACCGAGCCGACCGGGACGGCCGGGGC
GACGAGCACGACGGCGACGGCAGCGAGCAACCCCCCCAGCGCGACCCGGACGCCGTCGCCGCCGGCACCCCTAGA
ACCGACAGCGAGCGTCTGGCCAGGATGCTCTCCAGCGCCCGCCGCAAGGCGCCCAAGCTGGAGAAGCAGCGCCGC
GACATGGCGCGGAGCCAGCTGCACGAGAGATGGAGGAGGCGCCAGTTCTATCTCGACGAGGAGGAGGGCGGCCTC
GCCCCGGACGACTGGGATAACGACGAGGACATACTCGCCAAGCTCAGCAAGGCCGTCGAAGACGCGCAGTCGGGC
GGCGACCAGCACAACGCCGCCCCCACCCGCTCGCGCTCCAGCTCCAAGGTCCGGTTCGCCGAGGACATGGACGAC
CATGACACGCGGTCCAACCCGTCGACGTCGTCGCGCAGCATCCCCGAGCGCTGGGGAGGCATGGGCATCCCGGAC
GCCGAGAAGGACGCCGGCCGAGAGATTCTCTACCAGGTGACGCAGCAGGCCTTCAACGAGCTGCTCGACACCATC
TTCAAGCCGGCCGAGGACCTGGCCGTCGAGGCGGCCACGACCAAGGCGCAGCGGGAGAGGTACAGGGCCGAGATC
GAGTCATTCCGAAAAGGCCGCCCAGGATAA
Gene >Hirsu2|398
ATGTGGCCATCGAGTTCCTCGGCCGAGACGCTGACGCGCCCGCGCGTGGCCGTGGCCCTCGTCTCGGCCGCCGCC
GCCGCCGCCTCCATTGGCTACTACGCCTACCAGGCCGGCTGGCCTTCATCGCTCTACCACCGTTCCCGCGCCGGC
AGCCTGCACCGGAGCAACGCCGTGCGACGCACGCGCCACAGCCGCGCCGCCAGAAACGACGCCGGCTCGAGCTCC
GAGTCCGAGGCCGCCGGGGACGAAAATGTCGAGGTCATCAACGACGCGGCCGCGGCCCGGCCCGCCGACGCCGAG
ACGGTCGTCGAGGTCGACGCCGGCGAGTGGTGGAACGACCCGTCGGGCTTCCAGCCGCCCCAGCGCGCCGGACAC
AACATCGTGAGCCTGCTGTTCCGCGTGTCCGAGGACAACGCCCGGCGGAACGGCTGCGTCCATCGAGGATGCCAG
TGTAATGCATGTGGCATGGTGCCCATCCGCGGCATCCGCTACCGCTGCGCCAACTGCGCCGACTTCGACCTGTGC
GAGACGTGCGAGGCCCAGGGCGTCCACATCAAGACGCACATCTTCTACAAGATCAGGGTCCCGGCCCCTCCCTTC
GGCCCCCGCCAGATGCAGCCCGTCTGGTACACGGGCGACCCGGACGTCTGCCGCCGCAGCCTGCCGCGCTCCCTG
ATCGCCCGCCTGTCGCGCGACACCGGCTTCGAGCGGCCCGAGCTCGAGGCCTTCTGGGAGCAGTGGACCTTCATG
GCCTTCTCCGAGCTGCGCGACGACCCGGACGAGCTGCTCGTCGCCATGGACCGCAAGACGTTCGAGCGATGCCTC
GTGCCCACCGGCGGCTCGCGCCACGCCACCCCCAACCTCATCCACGACCGCATGTTCGCCTTCTACGACTCCAAC
AACGACGGCCTCATCAGCTTCGCCGAGTTCCTGCACGGCCTCTCCTACCGGAAGCGCAAGGACAAGCTGCGTAAG
GTCTTCGAGGGCTACGACATCGACAACGACGGCTACGTCAACCGCCGCGACTTCCTCCGCATGTTTCGCGCCTAC
TACGTCCTCTACAAGCAGATGCACAAGGACATCCTCGACGGGCTCGAGGACCAGCTCCTCACCAGCGGCGAGGCC
ATCGCCGTCGTCCATAGCCGCCAGCCGCTCAGCAGCCTCTTCGGCCGCGAGGGCAGGGTCCCTCCCGCCGACGGC
AACATGCGCTTCGACGGCAAGACCTACCACCGGGACGGCACCATCGACGTCGACGACGCCCACCAGAGGGCGACC
GTCGAGAACCACGGAGACACGGCGAGCCGCGAGGACATTCTGACGAGCCTGTTCGCCTACGACACGTACCAACGG
CCCCGCCGCCGCTTCGTCGCCCGGAGAGACACCGACACCAACTGGCGCACCGTCCGCCGCCTGAGCGGCACCGAG
ACGGACCGCGCCTACTGGGTCACTCTCCTCGACCCGCCCGCCACGCTGGACGAGATCCCCGGCGTGCTCGACGGC
AGCAACAACCCGGGGGTCGAGGAGAGCGACGACGACGAGGCCGACGACGACCGAGCCGACCGGGACGGCCGGGGC
GACGAGCACGACGGCGACGGCAGCGAGCAACCCCCCCAGCGCGACCCGGACGCCGTCGCCGCCGGCACCCCTAGA
ACCGACAGCGAGCGTCTGGCCAGGATGCTCTCCAGCGCCCGCCGCAAGGCGCCCAAGCTGGAGAAGCAGCGCCGC
GACATGGCGCGGAGCCAGCTGCACGAGAGATGGAGGAGGCGCCAGTTCTATCTCGACGAGGAGGAGGGCGGCCTC
GCCCCGGACGACTGGGATAACGACGAGGACATACTCGCCAAGCTCAGCAAGGCCGTCGAAGACGCGCAGTCGGGC
GGCGACCAGCACAACGCCGCCCCCACCCGCTCGCGCTCCAGCTCCAAGGTCCGGTTCGCCGAGGACATGGACGAC
CATGACACGCGGTCCAACCCGTCGACGTCGTCGCGCAGCATCCCCGAGCGCTGGGGAGGCATGGGCATCCCGGAC
GCCGAGAAGGACGCCGGCCGAGAGATTCTCTACCAGGTGACGCAGCAGGCCTTCAACGAGCTGCTCGACACCATC
TTCAAGCCGGCCGAGGACCTGGCCGTCGAGGCGGCCACGACCAAGGCGCAGCGGGAGAGGTACAGGGCCGAGATC
GAGTCAGTCGAGGCCGAGGACGACAAGGACCAGGAGGCCAAGGCCCCCGAGCAGGCGACCCCCAGCCGCAGTTCC
GAAAAGGCCGCCCAGGATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail