Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3977
Gene name
LocationContig_208:11795..13046
Strand+
Gene length (bp)1251
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04666 Glyco_transf_54 N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region 3.5E-08 65 119

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q812F8|MGT4B_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B OS=Mus musculus GN=Mgat4b PE=2 SV=1 73 237 2.0E-10
sp|Q9UQ53|MGT4B_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B OS=Homo sapiens GN=MGAT4B PE=1 SV=1 73 237 2.0E-09
sp|Q6GMK0|MGT4B_DANRE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B OS=Danio rerio GN=mgat4b PE=2 SV=1 73 220 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 250 272 22
3 293 315 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3977
MRPSRANAVFWLAWLCLALWCYLDTYDDPSSIFYDPARAYRPRFSFARTTEVDRFLHQTASAAPQSRAQEPLLCV
GIPSVNRSTESFVQHTVGSLVDTLSPAERELVYIVVLLADSSPQSHFAYGKDWLGRLPDEVLVYTEHGGPASGGN
TTAAAKNYHAIPYHVRGEPRSKERVENMRLDHSVLVEHCRLRGTPYFALIEDDVVASRNWFARLRTALQHVERRA
TRTGRDWIYLRLFYSELLMGWNAEEWLSYAEVVFGAYAVLLLVLLELRRRHWLGGPAGAGPSKGAGQNYACALVL
CLWTPATIALFFVAGRVSLHRLSPFPLSGVREMPNYGCCAQGLVFPRRHLAGLQDLLRNPPFAFAGDQILEDYAR
DHGLAKWALDPSVLQHAGRRQSSDGPRTADVWNFSFERQRA*
Coding >Hirsu2|3977
ATGCGCCCCTCGCGCGCCAACGCCGTCTTCTGGCTGGCCTGGCTGTGCCTGGCTCTGTGGTGCTACCTCGACACC
TACGACGACCCTTCCTCCATCTTCTACGACCCGGCCAGGGCCTACCGGCCGCGCTTCTCCTTCGCCCGCACCACC
GAGGTCGATCGCTTCCTGCACCAGACGGCCTCGGCCGCTCCCCAGTCGCGAGCCCAAGAGCCCCTCCTGTGCGTC
GGCATCCCCAGCGTCAACCGCAGCACCGAGTCCTTCGTCCAGCACACCGTCGGCAGCCTCGTCGACACCCTGTCG
CCCGCCGAGCGCGAGCTCGTCTACATCGTCGTCCTGCTGGCCGACAGCTCGCCCCAGTCGCACTTCGCCTACGGC
AAGGACTGGCTCGGCCGCCTGCCCGACGAGGTGCTCGTCTACACCGAACACGGCGGCCCCGCCTCTGGCGGCAAC
ACGACCGCCGCGGCGAAAAACTATCATGCCATCCCCTACCACGTCCGCGGCGAACCGCGCAGCAAGGAACGTGTC
GAGAACATGCGCCTCGACCATTCGGTGCTGGTGGAGCACTGCCGCCTCCGCGGCACTCCCTACTTCGCCCTCATC
GAGGACGACGTCGTCGCCTCGCGCAACTGGTTCGCGCGCCTCCGCACAGCCCTGCAGCACGTGGAGCGGCGCGCG
ACGCGCACCGGCCGCGACTGGATCTACCTGCGCCTTTTCTACTCGGAGCTGCTCATGGGCTGGAACGCCGAGGAG
TGGCTGAGCTACGCCGAGGTCGTCTTCGGCGCCTACGCCGTCCTGCTGCTGGTCCTACTCGAGCTGCGCCGCCGG
CACTGGCTCGGCGGCCCGGCCGGCGCCGGGCCTTCCAAGGGCGCCGGGCAGAACTACGCCTGCGCCCTGGTGCTG
TGCCTCTGGACGCCCGCCACCATCGCCCTCTTCTTCGTGGCCGGGCGCGTCTCGCTGCACCGGCTGAGCCCGTTC
CCGCTGAGCGGCGTGCGCGAGATGCCCAACTACGGCTGCTGCGCCCAGGGGCTCGTCTTCCCGCGCCGCCACCTG
GCCGGCCTGCAGGACCTGCTGCGCAACCCGCCCTTCGCCTTCGCCGGCGACCAGATCCTCGAGGACTACGCCCGC
GACCACGGCCTGGCCAAATGGGCCCTCGACCCGAGCGTCCTGCAGCATGCCGGCCGCCGCCAGTCGTCGGATGGG
CCGCGCACCGCCGACGTGTGGAACTTTAGCTTCGAGAGGCAGCGGGCCTGA
Transcript >Hirsu2|3977
ATGCGCCCCTCGCGCGCCAACGCCGTCTTCTGGCTGGCCTGGCTGTGCCTGGCTCTGTGGTGCTACCTCGACACC
TACGACGACCCTTCCTCCATCTTCTACGACCCGGCCAGGGCCTACCGGCCGCGCTTCTCCTTCGCCCGCACCACC
GAGGTCGATCGCTTCCTGCACCAGACGGCCTCGGCCGCTCCCCAGTCGCGAGCCCAAGAGCCCCTCCTGTGCGTC
GGCATCCCCAGCGTCAACCGCAGCACCGAGTCCTTCGTCCAGCACACCGTCGGCAGCCTCGTCGACACCCTGTCG
CCCGCCGAGCGCGAGCTCGTCTACATCGTCGTCCTGCTGGCCGACAGCTCGCCCCAGTCGCACTTCGCCTACGGC
AAGGACTGGCTCGGCCGCCTGCCCGACGAGGTGCTCGTCTACACCGAACACGGCGGCCCCGCCTCTGGCGGCAAC
ACGACCGCCGCGGCGAAAAACTATCATGCCATCCCCTACCACGTCCGCGGCGAACCGCGCAGCAAGGAACGTGTC
GAGAACATGCGCCTCGACCATTCGGTGCTGGTGGAGCACTGCCGCCTCCGCGGCACTCCCTACTTCGCCCTCATC
GAGGACGACGTCGTCGCCTCGCGCAACTGGTTCGCGCGCCTCCGCACAGCCCTGCAGCACGTGGAGCGGCGCGCG
ACGCGCACCGGCCGCGACTGGATCTACCTGCGCCTTTTCTACTCGGAGCTGCTCATGGGCTGGAACGCCGAGGAG
TGGCTGAGCTACGCCGAGGTCGTCTTCGGCGCCTACGCCGTCCTGCTGCTGGTCCTACTCGAGCTGCGCCGCCGG
CACTGGCTCGGCGGCCCGGCCGGCGCCGGGCCTTCCAAGGGCGCCGGGCAGAACTACGCCTGCGCCCTGGTGCTG
TGCCTCTGGACGCCCGCCACCATCGCCCTCTTCTTCGTGGCCGGGCGCGTCTCGCTGCACCGGCTGAGCCCGTTC
CCGCTGAGCGGCGTGCGCGAGATGCCCAACTACGGCTGCTGCGCCCAGGGGCTCGTCTTCCCGCGCCGCCACCTG
GCCGGCCTGCAGGACCTGCTGCGCAACCCGCCCTTCGCCTTCGCCGGCGACCAGATCCTCGAGGACTACGCCCGC
GACCACGGCCTGGCCAAATGGGCCCTCGACCCGAGCGTCCTGCAGCATGCCGGCCGCCGCCAGTCGTCGGATGGG
CCGCGCACCGCCGACGTGTGGAACTTTAGCTTCGAGAGGCAGCGGGCCTGA
Gene >Hirsu2|3977
ATGCGCCCCTCGCGCGCCAACGCCGTCTTCTGGCTGGCCTGGCTGTGCCTGGCTCTGTGGTGCTACCTCGACACC
TACGACGACCCTTCCTCCATCTTCTACGACCCGGCCAGGGCCTACCGGCCGCGCTTCTCCTTCGCCCGCACCACC
GAGGTCGATCGCTTCCTGCACCAGACGGCCTCGGCCGCTCCCCAGTCGCGAGCCCAAGAGCCCCTCCTGTGCGTC
GGCATCCCCAGCGTCAACCGCAGCACCGAGTCCTTCGTCCAGCACACCGTCGGCAGCCTCGTCGACACCCTGTCG
CCCGCCGAGCGCGAGCTCGTCTACATCGTCGTCCTGCTGGCCGACAGCTCGCCCCAGTCGCACTTCGCCTACGGC
AAGGACTGGCTCGGCCGCCTGCCCGACGAGGTGCTCGTCTACACCGAACACGGCGGCCCCGCCTCTGGCGGCAAC
ACGACCGCCGCGGCGAAAAACTATCATGCCATCCCCTACCACGTCCGCGGCGAACCGCGCAGCAAGGAACGTGTC
GAGAACATGCGCCTCGACCATTCGGTGCTGGTGGAGCACTGCCGCCTCCGCGGCACTCCCTACTTCGCCCTCATC
GAGGACGACGTCGTCGCCTCGCGCAACTGGTTCGCGCGCCTCCGCACAGCCCTGCAGCACGTGGAGCGGCGCGCG
ACGCGCACCGGCCGCGACTGGATCTACCTGCGCCTTTTCTACTCGGAGCTGCTCATGGGCTGGAACGCCGAGGAG
TGGCTGAGCTACGCCGAGGTCGTCTTCGGCGCCTACGCCGTCCTGCTGCTGGTCCTACTCGAGCTGCGCCGCCGG
CACTGGCTCGGCGGCCCGGCCGGCGCCGGGCCTTCCAAGGGCGCCGGGCAGAACTACGCCTGCGCCCTGGTGCTG
TGCCTCTGGACGCCCGCCACCATCGCCCTCTTCTTCGTGGCCGGGCGCGTCTCGCTGCACCGGCTGAGCCCGTTC
CCGCTGAGCGGCGTGCGCGAGATGCCCAACTACGGCTGCTGCGCCCAGGGGCTCGTCTTCCCGCGCCGCCACCTG
GCCGGCCTGCAGGACCTGCTGCGCAACCCGCCCTTCGCCTTCGCCGGCGACCAGATCCTCGAGGACTACGCCCGC
GACCACGGCCTGGCCAAATGGGCCCTCGACCCGAGCGTCCTGCAGCATGCCGGCCGCCGCCAGTCGTCGGATGGG
CCGCGCACCGCCGACGTGTGGAACTTTAGCTTCGAGAGGCAGCGGGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail