Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3974
Gene name
LocationContig_208:8546..8900
Strand-
Gene length (bp)354
Transcript length (bp)354
Coding sequence length (bp)354
Protein length (aa) 118

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 7 114 8.0E-10
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 9 116 3.0E-09
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 5 117 1.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3974
MLVTLVLAAAATALAAPAKQAACSDGIMTYYEPGLGACEQTNNGDEPVVAVSALLFDEQRPCGRRIRINYHGRTA
EVGVVDRCTGCARNDLDVSPAVFTKLAGSLDAGRLPISWEWI*
Coding >Hirsu2|3974
ATGCTCGTCACTCTTGTCCTCGCCGCCGCCGCCACGGCCCTCGCCGCCCCGGCCAAACAGGCTGCCTGCTCCGAC
GGCATTATGACCTATTACGAACCGGGGCTGGGCGCCTGCGAGCAGACCAACAACGGCGACGAGCCCGTTGTCGCT
GTATCGGCCCTCCTTTTCGATGAGCAGCGCCCGTGCGGCCGCCGCATCCGCATCAACTACCACGGCCGCACCGCC
GAAGTCGGCGTCGTCGACCGCTGCACCGGTTGCGCTCGTAACGACCTCGACGTCTCCCCAGCCGTCTTCACGAAG
CTCGCCGGCAGCCTCGACGCGGGCCGCCTCCCCATCTCCTGGGAATGGATCTAG
Transcript >Hirsu2|3974
ATGCTCGTCACTCTTGTCCTCGCCGCCGCCGCCACGGCCCTCGCCGCCCCGGCCAAACAGGCTGCCTGCTCCGAC
GGCATTATGACCTATTACGAACCGGGGCTGGGCGCCTGCGAGCAGACCAACAACGGCGACGAGCCCGTTGTCGCT
GTATCGGCCCTCCTTTTCGATGAGCAGCGCCCGTGCGGCCGCCGCATCCGCATCAACTACCACGGCCGCACCGCC
GAAGTCGGCGTCGTCGACCGCTGCACCGGTTGCGCTCGTAACGACCTCGACGTCTCCCCAGCCGTCTTCACGAAG
CTCGCCGGCAGCCTCGACGCGGGCCGCCTCCCCATCTCCTGGGAATGGATCTAG
Gene >Hirsu2|3974
ATGCTCGTCACTCTTGTCCTCGCCGCCGCCGCCACGGCCCTCGCCGCCCCGGCCAAACAGGCTGCCTGCTCCGAC
GGCATTATGACCTATTACGAACCGGGGCTGGGCGCCTGCGAGCAGACCAACAACGGCGACGAGCCCGTTGTCGCT
GTATCGGCCCTCCTTTTCGATGAGCAGCGCCCGTGCGGCCGCCGCATCCGCATCAACTACCACGGCCGCACCGCC
GAAGTCGGCGTCGTCGACCGCTGCACCGGTTGCGCTCGTAACGACCTCGACGTCTCCCCAGCCGTCTTCACGAAG
CTCGCCGGCAGCCTCGACGCGGGCCGCCTCCCCATCTCCTGGGAATGGATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail