Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3968
Gene name
LocationContig_2078:1017..3623
Strand-
Gene length (bp)2606
Transcript length (bp)2532
Coding sequence length (bp)2532
Protein length (aa) 844

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain 3.2E-15 80 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q52FM1|PALF_MAGO7 pH-response regulator protein palF/RIM8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM8 PE=3 SV=2 52 843 0.0E+00
sp|Q7SGZ5|PALF_NEUCR pH-response regulator protein palF/prr-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-3 PE=3 SV=2 43 826 2.0E-178
sp|P78612|PALF_EMENI pH-response regulator protein palF/RIM8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palF PE=2 SV=1 54 843 6.0E-126
sp|Q9UW13|PALF_CANAL pH-response regulator protein palF/RIM8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM8 PE=2 SV=2 70 701 8.0E-30
sp|Q754G2|PALF_ASHGO pH-response regulator protein palF/RIM8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM8 PE=3 SV=1 77 560 6.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q52FM1|PALF_MAGO7 pH-response regulator protein palF/RIM8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM8 PE=3 SV=2 52 843 0.0E+00
sp|Q7SGZ5|PALF_NEUCR pH-response regulator protein palF/prr-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-3 PE=3 SV=2 43 826 2.0E-178
sp|P78612|PALF_EMENI pH-response regulator protein palF/RIM8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palF PE=2 SV=1 54 843 6.0E-126
sp|Q9UW13|PALF_CANAL pH-response regulator protein palF/RIM8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM8 PE=2 SV=2 70 701 8.0E-30
sp|Q754G2|PALF_ASHGO pH-response regulator protein palF/RIM8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM8 PE=3 SV=1 77 560 6.0E-27
sp|Q6BY20|PALF_DEBHA pH-response regulator protein palF/RIM8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RIM8 PE=3 SV=2 77 701 2.0E-25
sp|Q9UVF5|PALF_YARLI pH-response regulator protein palF/RIM8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM8 PE=3 SV=1 340 791 2.0E-24
sp|Q6CTM7|PALF_KLULA pH-response regulator protein palF/RIM8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RIM8 PE=3 SV=1 77 560 5.0E-18
sp|Q6FVR8|PALF_CANGA pH-response regulator protein palF/RIM8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RIM8 PE=3 SV=1 80 501 1.0E-11
sp|Q9UVF5|PALF_YARLI pH-response regulator protein palF/RIM8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM8 PE=3 SV=1 172 256 8.0E-08
sp|P53179|PALF_YEAST pH-response regulator protein palF/RIM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM8 PE=1 SV=2 74 256 8.0E-08
sp|A0A0B4J1F4|ARRD4_MOUSE Arrestin domain-containing protein 4 OS=Mus musculus GN=Arrdc4 PE=2 SV=1 85 355 1.0E-07
sp|Q8NCT1|ARRD4_HUMAN Arrestin domain-containing protein 4 OS=Homo sapiens GN=ARRDC4 PE=1 SV=3 85 355 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3968
MPLDPPSGAPARPSTSSSLPTVALDDDAASDADISPDGRPPNTSSVASKHKHASRPSLLSRLSLPLSLPLRSRNR
NVVDFHVRCDEPYRKYSAGDPVRGSVVLAVVRPLRITHLVVSLQGQVRVLKDPTSAAKAQLAAASSPGGSSAQPQ
YHGNGFASLFQDEQVLSGEGRLEPGKYEFGFDLVFPDTELPSSIDFERGTIAYMITAILTRPTTIAPTSSCDRKV
VLAQKIDIGMLAPPRPRTIFLEPISKRARRKKTPASAASPIAEVNDAASEPDSGDRSVFTDDSGRDTQADHRTHI
PSDLRSEISGESGRSASTAVSKADAAQPPNTGPTMTPAAKQQVVDDKTITATIELLRGGCLPGDTVSARVTVQHI
KRVKSMTGVIVTLFRQGKIDTSPPLSRFAPMNKDEARKLEKEEMYPRSRTSLGGLSLSSTSSTSVFRKDLDQNAA
PLIIDPATLQASVTISVKVPDDAFPTIKGVPGDMISFKYQVEVVVDLGGRLASQLQRGQSSSRFGPYGSAGSDQG
PNSYGPLRSTNIADTAQLRREKGVISVSMETVVGTTDSSRGRKSTRKPPESRTVRIYESDADADEAICPEPAAQP
ADPASYIYAGAQQQSHNRQLSQLPAGFPFVPPPGEPPPPPAPLHIFPSEAPPRDDAAQPNPYRLNDAPSYIPAPQ
VPDQSNMTEKERIRQAETRLLPSQPPAMSAAAAADDDGDDNIYDAEETPRARRPGSEPSAPVGHDAEAGPSAPTE
EQLSTSTDQRAEDKQELERLRLLSEASAPPEFPDDIERRAEGPLALDPADEEPSAPVLLADEEYPGYGGTVAAGP
SSGTSMRQHPEQLPAYER*
Coding >Hirsu2|3968
ATGCCTCTCGACCCTCCTTCCGGCGCTCCCGCCCGCCCCTCGACCTCGTCGTCGCTCCCCACCGTCGCCCTTGAC
GACGACGCCGCCTCCGACGCCGACATCAGTCCAGACGGCCGCCCCCCCAATACCTCGTCCGTGGCTTCCAAGCAC
AAGCACGCCTCGCGCCCCAGCCTGCTGTCGCGACTCAGCCTGCCCCTGTCCCTCCCCCTGCGCAGCCGCAACCGC
AACGTCGTCGACTTCCACGTCCGCTGTGACGAGCCCTACAGGAAGTACAGCGCTGGCGACCCCGTCCGCGGCTCC
GTCGTCCTCGCCGTCGTCCGTCCCCTGCGCATCACCCATCTCGTCGTCTCCCTCCAGGGCCAGGTCCGCGTCCTC
AAAGACCCGACCTCGGCCGCCAAGGCCCAGCTCGCCGCCGCCTCGTCTCCGGGCGGCAGCTCCGCCCAGCCCCAG
TACCACGGAAACGGCTTCGCCAGCCTCTTCCAGGACGAGCAGGTCCTCAGCGGCGAGGGCAGGCTTGAGCCCGGC
AAGTACGAGTTTGGCTTCGACCTCGTCTTTCCCGACACCGAGCTGCCCAGCAGCATTGACTTTGAGAGAGGCACC
ATCGCCTACATGATCACCGCCATCCTGACCAGGCCGACGACGATTGCCCCGACCTCGTCGTGCGACCGCAAAGTC
GTGCTCGCCCAGAAGATCGACATCGGCATGCTCGCCCCGCCGCGCCCGAGGACCATCTTCCTTGAGCCCATCTCC
AAGCGCGCGCGCAGGAAGAAGACGCCGGCCTCGGCCGCGAGCCCCATCGCCGAGGTCAACGACGCTGCCTCCGAG
CCCGACTCGGGTGACCGCTCCGTCTTCACCGACGATTCGGGCCGCGACACGCAGGCAGACCACCGCACCCACATC
CCGAGCGACCTGCGCAGCGAGATCAGCGGCGAGAGCGGCCGCAGCGCGAGCACCGCCGTCAGCAAGGCCGATGCC
GCCCAGCCGCCCAACACCGGCCCAACCATGACGCCCGCCGCCAAGCAGCAGGTCGTCGACGACAAGACCATCACC
GCCACCATCGAGCTCCTGAGGGGCGGCTGCCTGCCGGGGGACACGGTGTCGGCGCGCGTCACCGTGCAGCACATC
AAGCGGGTCAAGAGCATGACGGGCGTCATCGTCACCCTCTTCCGCCAGGGCAAGATCGACACCTCGCCCCCGCTC
TCGCGCTTCGCCCCCATGAACAAGGACGAGGCCCGCAAGCTGGAGAAGGAGGAGATGTACCCGCGATCCCGCACC
AGCCTCGGCGGCCTGTCGCTCTCCTCCACCAGCTCCACCAGCGTCTTCCGCAAAGACCTGGACCAGAACGCGGCG
CCCCTCATCATCGACCCGGCCACCCTGCAGGCCTCGGTCACGATATCCGTCAAGGTGCCCGACGACGCCTTCCCC
ACCATCAAGGGCGTGCCCGGCGACATGATCAGCTTCAAGTATCAGGTCGAGGTCGTCGTCGACCTGGGCGGCAGA
CTGGCCAGCCAACTGCAGCGCGGGCAGTCGTCTTCGAGGTTCGGGCCCTACGGCAGCGCCGGCTCGGACCAGGGC
CCCAACTCGTACGGGCCGCTGCGGTCGACCAACATTGCCGACACGGCGCAGCTGAGGAGGGAGAAGGGCGTCATC
TCCGTGTCCATGGAGACCGTCGTCGGCACGACGGACAGCTCCAGGGGCCGCAAGTCGACGAGGAAGCCACCCGAG
TCGAGGACGGTCAGGATCTACGAAAGCGACGCCGACGCCGACGAGGCCATTTGCCCGGAGCCAGCCGCCCAACCC
GCGGACCCCGCAAGCTACATCTACGCAGGCGCCCAGCAGCAGTCGCACAACAGGCAGTTGTCACAACTGCCCGCC
GGTTTCCCGTTCGTCCCGCCTCCGGGAGAGCCGCCGCCGCCCCCGGCCCCTCTGCACATCTTCCCATCCGAGGCA
CCGCCGCGCGACGATGCTGCCCAGCCGAACCCTTACCGTCTCAACGACGCCCCCTCATATATCCCGGCGCCCCAA
GTCCCCGACCAGAGCAACATGACGGAGAAGGAGCGCATACGACAAGCGGAAACGAGACTGCTGCCCAGTCAGCCG
CCCGCTATGAGCGCCGCCGCCGCCGCCGATGACGATGGCGATGACAACATCTACGACGCTGAAGAGACGCCCAGG
GCTAGGCGACCGGGATCGGAACCCAGCGCGCCGGTCGGGCACGACGCCGAGGCTGGACCATCGGCGCCAACGGAG
GAACAGCTATCCACATCCACAGACCAACGGGCCGAGGACAAGCAGGAGCTGGAGCGTCTGAGACTCCTGAGCGAG
GCCAGTGCGCCTCCCGAATTTCCCGACGACATTGAAAGGAGGGCCGAGGGTCCATTGGCTCTTGACCCGGCGGAC
GAGGAGCCGTCGGCGCCAGTTCTGCTTGCCGATGAGGAATATCCCGGCTATGGCGGCACGGTCGCGGCGGGACCT
TCGAGCGGCACGAGCATGAGGCAGCACCCGGAGCAGCTGCCGGCATATGAGCGTTAA
Transcript >Hirsu2|3968
ATGCCTCTCGACCCTCCTTCCGGCGCTCCCGCCCGCCCCTCGACCTCGTCGTCGCTCCCCACCGTCGCCCTTGAC
GACGACGCCGCCTCCGACGCCGACATCAGTCCAGACGGCCGCCCCCCCAATACCTCGTCCGTGGCTTCCAAGCAC
AAGCACGCCTCGCGCCCCAGCCTGCTGTCGCGACTCAGCCTGCCCCTGTCCCTCCCCCTGCGCAGCCGCAACCGC
AACGTCGTCGACTTCCACGTCCGCTGTGACGAGCCCTACAGGAAGTACAGCGCTGGCGACCCCGTCCGCGGCTCC
GTCGTCCTCGCCGTCGTCCGTCCCCTGCGCATCACCCATCTCGTCGTCTCCCTCCAGGGCCAGGTCCGCGTCCTC
AAAGACCCGACCTCGGCCGCCAAGGCCCAGCTCGCCGCCGCCTCGTCTCCGGGCGGCAGCTCCGCCCAGCCCCAG
TACCACGGAAACGGCTTCGCCAGCCTCTTCCAGGACGAGCAGGTCCTCAGCGGCGAGGGCAGGCTTGAGCCCGGC
AAGTACGAGTTTGGCTTCGACCTCGTCTTTCCCGACACCGAGCTGCCCAGCAGCATTGACTTTGAGAGAGGCACC
ATCGCCTACATGATCACCGCCATCCTGACCAGGCCGACGACGATTGCCCCGACCTCGTCGTGCGACCGCAAAGTC
GTGCTCGCCCAGAAGATCGACATCGGCATGCTCGCCCCGCCGCGCCCGAGGACCATCTTCCTTGAGCCCATCTCC
AAGCGCGCGCGCAGGAAGAAGACGCCGGCCTCGGCCGCGAGCCCCATCGCCGAGGTCAACGACGCTGCCTCCGAG
CCCGACTCGGGTGACCGCTCCGTCTTCACCGACGATTCGGGCCGCGACACGCAGGCAGACCACCGCACCCACATC
CCGAGCGACCTGCGCAGCGAGATCAGCGGCGAGAGCGGCCGCAGCGCGAGCACCGCCGTCAGCAAGGCCGATGCC
GCCCAGCCGCCCAACACCGGCCCAACCATGACGCCCGCCGCCAAGCAGCAGGTCGTCGACGACAAGACCATCACC
GCCACCATCGAGCTCCTGAGGGGCGGCTGCCTGCCGGGGGACACGGTGTCGGCGCGCGTCACCGTGCAGCACATC
AAGCGGGTCAAGAGCATGACGGGCGTCATCGTCACCCTCTTCCGCCAGGGCAAGATCGACACCTCGCCCCCGCTC
TCGCGCTTCGCCCCCATGAACAAGGACGAGGCCCGCAAGCTGGAGAAGGAGGAGATGTACCCGCGATCCCGCACC
AGCCTCGGCGGCCTGTCGCTCTCCTCCACCAGCTCCACCAGCGTCTTCCGCAAAGACCTGGACCAGAACGCGGCG
CCCCTCATCATCGACCCGGCCACCCTGCAGGCCTCGGTCACGATATCCGTCAAGGTGCCCGACGACGCCTTCCCC
ACCATCAAGGGCGTGCCCGGCGACATGATCAGCTTCAAGTATCAGGTCGAGGTCGTCGTCGACCTGGGCGGCAGA
CTGGCCAGCCAACTGCAGCGCGGGCAGTCGTCTTCGAGGTTCGGGCCCTACGGCAGCGCCGGCTCGGACCAGGGC
CCCAACTCGTACGGGCCGCTGCGGTCGACCAACATTGCCGACACGGCGCAGCTGAGGAGGGAGAAGGGCGTCATC
TCCGTGTCCATGGAGACCGTCGTCGGCACGACGGACAGCTCCAGGGGCCGCAAGTCGACGAGGAAGCCACCCGAG
TCGAGGACGGTCAGGATCTACGAAAGCGACGCCGACGCCGACGAGGCCATTTGCCCGGAGCCAGCCGCCCAACCC
GCGGACCCCGCAAGCTACATCTACGCAGGCGCCCAGCAGCAGTCGCACAACAGGCAGTTGTCACAACTGCCCGCC
GGTTTCCCGTTCGTCCCGCCTCCGGGAGAGCCGCCGCCGCCCCCGGCCCCTCTGCACATCTTCCCATCCGAGGCA
CCGCCGCGCGACGATGCTGCCCAGCCGAACCCTTACCGTCTCAACGACGCCCCCTCATATATCCCGGCGCCCCAA
GTCCCCGACCAGAGCAACATGACGGAGAAGGAGCGCATACGACAAGCGGAAACGAGACTGCTGCCCAGTCAGCCG
CCCGCTATGAGCGCCGCCGCCGCCGCCGATGACGATGGCGATGACAACATCTACGACGCTGAAGAGACGCCCAGG
GCTAGGCGACCGGGATCGGAACCCAGCGCGCCGGTCGGGCACGACGCCGAGGCTGGACCATCGGCGCCAACGGAG
GAACAGCTATCCACATCCACAGACCAACGGGCCGAGGACAAGCAGGAGCTGGAGCGTCTGAGACTCCTGAGCGAG
GCCAGTGCGCCTCCCGAATTTCCCGACGACATTGAAAGGAGGGCCGAGGGTCCATTGGCTCTTGACCCGGCGGAC
GAGGAGCCGTCGGCGCCAGTTCTGCTTGCCGATGAGGAATATCCCGGCTATGGCGGCACGGTCGCGGCGGGACCT
TCGAGCGGCACGAGCATGAGGCAGCACCCGGAGCAGCTGCCGGCATATGAGCGTTAA
Gene >Hirsu2|3968
ATGCCTCTCGACCCTCCTTCCGGCGCTCCCGCCCGCCCCTCGACCTCGTCGTCGCTCCCCACCGTCGCCCTTGAC
GACGACGCCGCCTCCGACGCCGACATCAGTCCAGACGGCCGCCCCCCCAATACCTCGTCCGTGGCTTCCAAGCAC
AAGCACGCCTCGCGCCCCAGCCTGCTGTCGCGACTCAGCCTGCCCCTGTCCCTCCCCCTGCGCAGCCGCAACCGC
AACGTCGTCGACTTCCACGTCCGCTGTGACGAGCCCTACAGGAAGTACAGCGCTGGCGACCCCGTCCGCGGCTCC
GTCGTCCTCGCCGTCGTCCGTCCCCTGCGCATCACCCATCTCGTCGTCTCCCTCCAGGGCCAGGTCCGCGTCCTC
AAAGACCCGACCTCGGCCGCCAAGGCCCAGCTCGCCGCCGCCTCGTCTCCGGGCGGCAGCTCCGCCCAGCCCCAG
TACCACGGAAACGGCTTCGCCAGCCTCTTCCAGGACGAGCAGGTCCTCAGCGGCGAGGGCAGGCTTGAGCCCGGC
AAGTACGAGTTTGGCTTCGACCTCGTCTTTCCCGACACCGAGCTGCCCAGCAGCATTGACGTAGGTTCCTCCGAC
GGCCCCCGAGAGTCGCCTGCCGGCACTCTGCCGCTGACCGCGACCTTGTCCTGCCGCAGTTTGAGAGAGGCACCA
TCGCCTACATGATCACCGCCATCCTGACCAGGCCGACGACGATTGCCCCGACCTCGTCGTGCGACCGCAAAGTCG
TGCTCGCCCAGAAGATCGACATCGGCATGCTCGCCCCGCCGCGCCCGAGGACCATCTTCCTTGAGCCCATCTCCA
AGCGCGCGCGCAGGAAGAAGACGCCGGCCTCGGCCGCGAGCCCCATCGCCGAGGTCAACGACGCTGCCTCCGAGC
CCGACTCGGGTGACCGCTCCGTCTTCACCGACGATTCGGGCCGCGACACGCAGGCAGACCACCGCACCCACATCC
CGAGCGACCTGCGCAGCGAGATCAGCGGCGAGAGCGGCCGCAGCGCGAGCACCGCCGTCAGCAAGGCCGATGCCG
CCCAGCCGCCCAACACCGGCCCAACCATGACGCCCGCCGCCAAGCAGCAGGTCGTCGACGACAAGACCATCACCG
CCACCATCGAGCTCCTGAGGGGCGGCTGCCTGCCGGGGGACACGGTGTCGGCGCGCGTCACCGTGCAGCACATCA
AGCGGGTCAAGAGCATGACGGGCGTCATCGTCACCCTCTTCCGCCAGGGCAAGATCGACACCTCGCCCCCGCTCT
CGCGCTTCGCCCCCATGAACAAGGACGAGGCCCGCAAGCTGGAGAAGGAGGAGATGTACCCGCGATCCCGCACCA
GCCTCGGCGGCCTGTCGCTCTCCTCCACCAGCTCCACCAGCGTCTTCCGCAAAGACCTGGACCAGAACGCGGCGC
CCCTCATCATCGACCCGGCCACCCTGCAGGCCTCGGTCACGATATCCGTCAAGGTGCCCGACGACGCCTTCCCCA
CCATCAAGGGCGTGCCCGGCGACATGATCAGCTTCAAGTATCAGGTCGAGGTCGTCGTCGACCTGGGCGGCAGAC
TGGCCAGCCAACTGCAGCGCGGGCAGTCGTCTTCGAGGTTCGGGCCCTACGGCAGCGCCGGCTCGGACCAGGGCC
CCAACTCGTACGGGCCGCTGCGGTCGACCAACATTGCCGACACGGCGCAGCTGAGGAGGGAGAAGGGCGTCATCT
CCGTGTCCATGGAGACCGTCGTCGGCACGACGGACAGCTCCAGGGGCCGCAAGTCGACGAGGAAGCCACCCGAGT
CGAGGACGGTCAGGATCTACGAAAGCGACGCCGACGCCGACGAGGCCATTTGCCCGGAGCCAGCCGCCCAACCCG
CGGACCCCGCAAGCTACATCTACGCAGGCGCCCAGCAGCAGTCGCACAACAGGCAGTTGTCACAACTGCCCGCCG
GTTTCCCGTTCGTCCCGCCTCCGGGAGAGCCGCCGCCGCCCCCGGCCCCTCTGCACATCTTCCCATCCGAGGCAC
CGCCGCGCGACGATGCTGCCCAGCCGAACCCTTACCGTCTCAACGACGCCCCCTCATATATCCCGGCGCCCCAAG
TCCCCGACCAGAGCAACATGACGGAGAAGGAGCGCATACGACAAGCGGAAACGAGACTGCTGCCCAGTCAGCCGC
CCGCTATGAGCGCCGCCGCCGCCGCCGATGACGATGGCGATGACAACATCTACGACGCTGAAGAGACGCCCAGGG
CTAGGCGACCGGGATCGGAACCCAGCGCGCCGGTCGGGCACGACGCCGAGGCTGGACCATCGGCGCCAACGGAGG
AACAGCTATCCACATCCACAGACCAACGGGCCGAGGACAAGCAGGAGCTGGAGCGTCTGAGACTCCTGAGCGAGG
CCAGTGCGCCTCCCGAATTTCCCGACGACATTGAAAGGAGGGCCGAGGGTCCATTGGCTCTTGACCCGGCGGACG
AGGAGCCGTCGGCGCCAGTTCTGCTTGCCGATGAGGAATATCCCGGCTATGGCGGCACGGTCGCGGCGGGACCTT
CGAGCGGCACGAGCATGAGGCAGCACCCGGAGCAGCTGCCGGCATATGAGCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail