Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3961
Gene name
LocationContig_2074:2078..2401
Strand+
Gene length (bp)323
Transcript length (bp)270
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5J6J2|SCPB_TRIRU Carboxypeptidase S1 homolog B OS=Trichophyton rubrum GN=SCPB PE=1 SV=1 5 83 4.0E-19
sp|C5FGX1|SCPB_ARTOC Carboxypeptidase S1 homolog B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPB PE=3 SV=1 21 83 4.0E-19
sp|D4AP52|SCPB_ARTBC Carboxypeptidase S1 homolog B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPB PE=3 SV=1 5 83 4.0E-19
sp|B6V867|SCPA_TRITO Carboxypeptidase S1 homolog A OS=Trichophyton tonsurans GN=SCPA PE=3 SV=1 2 83 4.0E-18
sp|A7UKV5|SPCA_TRIEQ Carboxypeptidase S1 homolog A OS=Trichophyton equinum GN=SCPA PE=3 SV=1 2 83 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5J6J2|SCPB_TRIRU Carboxypeptidase S1 homolog B OS=Trichophyton rubrum GN=SCPB PE=1 SV=1 5 83 4.0E-19
sp|C5FGX1|SCPB_ARTOC Carboxypeptidase S1 homolog B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPB PE=3 SV=1 21 83 4.0E-19
sp|D4AP52|SCPB_ARTBC Carboxypeptidase S1 homolog B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPB PE=3 SV=1 5 83 4.0E-19
sp|B6V867|SCPA_TRITO Carboxypeptidase S1 homolog A OS=Trichophyton tonsurans GN=SCPA PE=3 SV=1 2 83 4.0E-18
sp|A7UKV5|SPCA_TRIEQ Carboxypeptidase S1 homolog A OS=Trichophyton equinum GN=SCPA PE=3 SV=1 2 83 4.0E-18
sp|C5FW30|SPCA_ARTOC Carboxypeptidase S1 homolog A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPA PE=3 SV=1 3 83 1.0E-17
sp|Q5J6J1|SPCA_TRIRU Carboxypeptidase S1 homolog A OS=Trichophyton rubrum GN=SCPA PE=1 SV=1 2 83 4.0E-17
sp|D4DD24|SCPA_TRIVH Carboxypeptidase S1 homolog A OS=Trichophyton verrucosum (strain HKI 0517) GN=SCPA PE=3 SV=1 2 83 1.0E-16
sp|D4AIF1|SCPA_ARTBC Carboxypeptidase S1 homolog A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPA PE=3 SV=1 2 83 2.0E-16
sp|D4AQ54|SCPC_ARTBC Carboxypeptidase Y homolog ARB_06361 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06361 PE=1 SV=1 4 82 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3961
MLGLALLWTAAAAAAGPRFPFPPVPEGLTVLRSKFHENVTISFKEPGICETTPGVRSFAGHIHLPPGLLDDDDGG
PQDYPVNTCVITSP*
Coding >Hirsu2|3961
ATGCTGGGCCTGGCGCTGCTCTGGACGGCCGCTGCCGCTGCCGCCGGCCCTCGGTTCCCCTTCCCGCCTGTGCCC
GAGGGCCTGACGGTCCTGAGGTCCAAGTTTCACGAGAACGTCACCATTTCCTTCAAAGAGCCCGGCATCTGCGAG
ACCACGCCCGGCGTCCGCTCCTTCGCCGGCCACATCCACCTGCCTCCGGGCCTCCTCGACGATGACGATGGCGGG
CCTCAAGACTACCCCGTCAACACGTGCGTCATCACCTCTCCCTGA
Transcript >Hirsu2|3961
ATGCTGGGCCTGGCGCTGCTCTGGACGGCCGCTGCCGCTGCCGCCGGCCCTCGGTTCCCCTTCCCGCCTGTGCCC
GAGGGCCTGACGGTCCTGAGGTCCAAGTTTCACGAGAACGTCACCATTTCCTTCAAAGAGCCCGGCATCTGCGAG
ACCACGCCCGGCGTCCGCTCCTTCGCCGGCCACATCCACCTGCCTCCGGGCCTCCTCGACGATGACGATGGCGGG
CCTCAAGACTACCCCGTCAACACGTGCGTCATCACCTCTCCCTGA
Gene >Hirsu2|3961
ATGCTGGGCCTGGCGCTGCTCTGGACGGCCGCTGCCGCTGCCGCCGGCCCTCGGTTCCCCTTCCCGCCTGTGCCC
GAGGGCCTGACGGTCCTGAGGTCCAAGTTTCACGAGAACGTCACCATTTCCTTCAAAGAGGTCCGTCGCCTCCCC
GCTGGGTCCTGAAGGCCACGAGCCCTGACGGCCGGCAGCCCGGCATCTGCGAGACCACGCCCGGCGTCCGCTCCT
TCGCCGGCCACATCCACCTGCCTCCGGGCCTCCTCGACGATGACGATGGCGGGCCTCAAGACTACCCCGTCAACA
CGTGCGTCATCACCTCTCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail