Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3960
Gene name
LocationContig_2073:678..3443
Strand-
Gene length (bp)2765
Transcript length (bp)2703
Coding sequence length (bp)2703
Protein length (aa) 901

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02141 DENN DENN (AEX-3) domain 7.6E-40 203 384
PF03456 uDENN uDENN domain 3.6E-06 107 171

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Q7|DENN_SCHPO DENN domain-containing protein C297.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC297.05 PE=1 SV=1 181 410 2.0E-11
sp|Q7Z401|MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens GN=DENND4A PE=1 SV=2 133 386 2.0E-10
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 71 389 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3960
MPPSLGTHPSLTRPRTGDRDGRPSTRDQGANDTMLIPSRTSSLHSRITQPIPSTLTAKPQQRTPKTLTHAYMVCG
VGREPSQWVKAPAPVQGKIGHMKGAVGQFWLPEILGSSPRLEQDNEVARALHAAMRACFPHDVEICTGRSQPHCV
HHAFVLQQDSSHTLYGICLRVWSRADDKRAETIRDLRKRTEPDFYDNADETYWIPYCLSFLSRYPLYNLLGDYLR
GMWIHWNKATNLFHAEEVSRILSFPAPRLNDLVRIDMKDYALCYQFPSSPTGFQNFALWPLFTCLSIPNIVGVVE
AAISPTRRIIFVSHYPAMLTVAAETVRYCVRVYEWSGLYVPVVHARHAQELVQEPGPYILGITAECRSLFTAPTD
ALVVDLDRNFVLTSSPPTALTPNQRNKFVTRLTQALNGDVTPSGVPQHLRSAYGGGKLVPAGPIIVERGQVESIQ
DPEWWNQDSVMAVMDHVCEKLGRNSGIKAVFGGSVKKPLMTKVSMRHLNEIVRERNQYSRDALEAWQDFINLKGR
MDTELSKVNKRNNYLVEELESWKQQFLKFQAFAEQLTKETQDLKVKIENHKRENRRLTGLIDQQKDDNARLSVRL
TGTEKQRDDALEALVLQQEIAEELERERKRNKKELSQLHHTNSTILRQRDEARRVVLHLRSLIGGQSHHMEHLIQ
SLTKPDELAQEIGQSLDGEEDEADDAATVDGKGSVKSAAHVSKRLSSLAFFDVADRHLKDKTDAIAHIVRNIADQ
CQAAVEGLQLAQDAETRSLRRQSNLSAAPSEDGTDDRSVATTEAGDDGRPQHSSGRTSSIPPTPDLIPNRSSTAM
SFASATTTPERSSQQYAVGGDIPTKIVEDDEEVFEENRSDNSAGPNENGVVAKHAPESLLHRPSGARISALGGSR
*
Coding >Hirsu2|3960
ATGCCTCCCTCCCTCGGCACCCATCCGTCCCTGACTCGCCCGCGCACCGGCGACCGCGATGGCCGTCCCAGCACC
CGCGACCAGGGCGCCAACGACACCATGCTCATCCCCAGCCGCACCTCGTCGCTGCACTCGCGCATCACCCAGCCC
ATCCCCTCGACCCTCACCGCCAAGCCCCAGCAGCGCACCCCCAAGACGCTCACGCATGCCTACATGGTCTGCGGC
GTCGGCCGCGAGCCGTCCCAATGGGTCAAGGCGCCCGCCCCCGTCCAGGGCAAGATCGGCCACATGAAGGGCGCC
GTCGGCCAGTTCTGGCTGCCCGAGATCCTCGGCAGCAGCCCTCGCCTCGAGCAGGACAACGAGGTGGCCCGCGCC
CTCCACGCCGCCATGAGGGCCTGCTTCCCCCACGACGTCGAGATCTGCACGGGCCGCAGCCAGCCTCACTGCGTC
CACCATGCCTTCGTCCTCCAGCAGGACTCCTCCCACACCCTCTACGGCATCTGCCTGCGCGTCTGGTCCCGCGCC
GACGACAAGCGGGCCGAGACGATCCGCGACCTGCGCAAGCGCACCGAGCCCGACTTTTACGACAACGCCGACGAG
ACGTACTGGATACCCTACTGCCTCTCCTTCCTCTCCCGCTACCCCCTCTACAACCTCCTCGGCGACTACCTCCGC
GGCATGTGGATTCACTGGAACAAGGCCACCAACCTCTTCCACGCCGAGGAGGTCTCGCGCATCCTCAGCTTCCCC
GCCCCGCGCCTCAATGACCTGGTCCGCATCGACATGAAGGACTACGCCCTCTGCTACCAGTTCCCCTCGTCGCCC
ACCGGCTTCCAGAACTTCGCCCTCTGGCCCCTCTTCACCTGCCTCTCCATCCCCAACATCGTCGGCGTCGTCGAG
GCCGCCATCTCCCCGACCCGCCGCATCATCTTCGTCAGCCACTACCCGGCCATGCTCACCGTCGCCGCCGAGACG
GTCCGCTACTGCGTCCGCGTCTACGAGTGGAGCGGCCTGTACGTGCCCGTCGTCCACGCCCGCCACGCCCAGGAG
CTCGTCCAGGAGCCCGGGCCCTACATCCTCGGCATCACCGCCGAGTGCCGCTCGCTCTTCACCGCCCCCACCGAC
GCCCTCGTCGTCGACCTCGACCGCAACTTCGTCCTCACCTCGAGCCCGCCCACCGCCCTGACGCCCAACCAGCGC
AACAAGTTCGTCACCCGCCTCACCCAGGCCCTCAACGGCGACGTCACCCCGTCCGGCGTGCCCCAGCACCTGCGC
TCCGCCTACGGCGGCGGCAAGCTGGTCCCGGCCGGTCCCATCATCGTCGAGCGCGGCCAGGTCGAGTCGATCCAG
GACCCCGAGTGGTGGAACCAGGACTCCGTCATGGCCGTCATGGACCACGTCTGCGAGAAGCTCGGCCGCAACTCG
GGCATCAAGGCCGTCTTCGGCGGCTCCGTCAAGAAGCCCCTCATGACAAAGGTCTCGATGCGCCACCTCAACGAG
ATCGTCCGCGAGAGGAACCAGTACTCCCGCGACGCCCTCGAGGCCTGGCAGGACTTCATCAACCTCAAGGGCCGC
ATGGACACGGAGCTCAGCAAGGTCAACAAGCGCAACAACTACCTCGTCGAGGAGCTCGAGAGCTGGAAGCAGCAG
TTCCTCAAGTTCCAGGCCTTCGCGGAGCAGCTCACCAAGGAGACGCAGGACCTCAAGGTCAAGATCGAGAACCAC
AAGAGGGAGAACCGCCGCCTGACGGGCCTCATCGACCAGCAAAAGGACGACAACGCCCGCCTCTCGGTCCGCCTC
ACCGGCACGGAGAAGCAGCGCGACGACGCGCTCGAGGCCCTCGTCCTGCAGCAGGAGATCGCCGAGGAGCTCGAG
CGCGAGCGCAAGCGGAACAAGAAGGAGCTCTCCCAGCTCCACCACACCAACAGCACCATCCTCCGCCAGCGCGAC
GAGGCCCGCCGCGTCGTCCTCCACCTGCGCAGCCTGATCGGCGGCCAGAGCCACCACATGGAGCACCTGATCCAG
TCCCTCACCAAGCCCGACGAGCTGGCGCAGGAGATCGGCCAGAGCCTCGACGGCGAGGAGGACGAGGCCGACGAC
GCGGCGACGGTCGACGGCAAGGGCTCCGTCAAGTCGGCGGCACACGTCAGCAAGCGCCTCTCGTCGCTCGCCTTC
TTCGACGTCGCCGACCGCCACCTCAAGGACAAGACGGACGCCATCGCCCACATCGTCCGCAACATCGCGGACCAG
TGCCAGGCCGCCGTCGAGGGCCTGCAGCTGGCCCAGGACGCCGAGACGCGCTCGCTGCGGCGCCAGAGCAACCTG
TCCGCCGCCCCGAGCGAGGACGGCACCGACGACCGGTCCGTCGCCACCACCGAGGCCGGCGACGACGGCCGGCCC
CAGCACAGCTCCGGCCGCACCTCGAGCATCCCCCCGACGCCGGACCTGATCCCCAACCGCAGCAGCACTGCCATG
TCGTTCGCGTCCGCGACGACCACCCCCGAGCGGTCCAGCCAGCAGTATGCCGTGGGCGGCGACATCCCCACCAAG
ATCGTCGAGGACGACGAGGAGGTGTTTGAGGAGAACCGGAGCGACAACAGCGCCGGCCCCAACGAGAACGGAGTC
GTCGCCAAGCACGCTCCCGAGAGTCTGCTCCACCGGCCCTCGGGCGCGAGGATCAGCGCCCTCGGCGGTTCCCGA
TAG
Transcript >Hirsu2|3960
ATGCCTCCCTCCCTCGGCACCCATCCGTCCCTGACTCGCCCGCGCACCGGCGACCGCGATGGCCGTCCCAGCACC
CGCGACCAGGGCGCCAACGACACCATGCTCATCCCCAGCCGCACCTCGTCGCTGCACTCGCGCATCACCCAGCCC
ATCCCCTCGACCCTCACCGCCAAGCCCCAGCAGCGCACCCCCAAGACGCTCACGCATGCCTACATGGTCTGCGGC
GTCGGCCGCGAGCCGTCCCAATGGGTCAAGGCGCCCGCCCCCGTCCAGGGCAAGATCGGCCACATGAAGGGCGCC
GTCGGCCAGTTCTGGCTGCCCGAGATCCTCGGCAGCAGCCCTCGCCTCGAGCAGGACAACGAGGTGGCCCGCGCC
CTCCACGCCGCCATGAGGGCCTGCTTCCCCCACGACGTCGAGATCTGCACGGGCCGCAGCCAGCCTCACTGCGTC
CACCATGCCTTCGTCCTCCAGCAGGACTCCTCCCACACCCTCTACGGCATCTGCCTGCGCGTCTGGTCCCGCGCC
GACGACAAGCGGGCCGAGACGATCCGCGACCTGCGCAAGCGCACCGAGCCCGACTTTTACGACAACGCCGACGAG
ACGTACTGGATACCCTACTGCCTCTCCTTCCTCTCCCGCTACCCCCTCTACAACCTCCTCGGCGACTACCTCCGC
GGCATGTGGATTCACTGGAACAAGGCCACCAACCTCTTCCACGCCGAGGAGGTCTCGCGCATCCTCAGCTTCCCC
GCCCCGCGCCTCAATGACCTGGTCCGCATCGACATGAAGGACTACGCCCTCTGCTACCAGTTCCCCTCGTCGCCC
ACCGGCTTCCAGAACTTCGCCCTCTGGCCCCTCTTCACCTGCCTCTCCATCCCCAACATCGTCGGCGTCGTCGAG
GCCGCCATCTCCCCGACCCGCCGCATCATCTTCGTCAGCCACTACCCGGCCATGCTCACCGTCGCCGCCGAGACG
GTCCGCTACTGCGTCCGCGTCTACGAGTGGAGCGGCCTGTACGTGCCCGTCGTCCACGCCCGCCACGCCCAGGAG
CTCGTCCAGGAGCCCGGGCCCTACATCCTCGGCATCACCGCCGAGTGCCGCTCGCTCTTCACCGCCCCCACCGAC
GCCCTCGTCGTCGACCTCGACCGCAACTTCGTCCTCACCTCGAGCCCGCCCACCGCCCTGACGCCCAACCAGCGC
AACAAGTTCGTCACCCGCCTCACCCAGGCCCTCAACGGCGACGTCACCCCGTCCGGCGTGCCCCAGCACCTGCGC
TCCGCCTACGGCGGCGGCAAGCTGGTCCCGGCCGGTCCCATCATCGTCGAGCGCGGCCAGGTCGAGTCGATCCAG
GACCCCGAGTGGTGGAACCAGGACTCCGTCATGGCCGTCATGGACCACGTCTGCGAGAAGCTCGGCCGCAACTCG
GGCATCAAGGCCGTCTTCGGCGGCTCCGTCAAGAAGCCCCTCATGACAAAGGTCTCGATGCGCCACCTCAACGAG
ATCGTCCGCGAGAGGAACCAGTACTCCCGCGACGCCCTCGAGGCCTGGCAGGACTTCATCAACCTCAAGGGCCGC
ATGGACACGGAGCTCAGCAAGGTCAACAAGCGCAACAACTACCTCGTCGAGGAGCTCGAGAGCTGGAAGCAGCAG
TTCCTCAAGTTCCAGGCCTTCGCGGAGCAGCTCACCAAGGAGACGCAGGACCTCAAGGTCAAGATCGAGAACCAC
AAGAGGGAGAACCGCCGCCTGACGGGCCTCATCGACCAGCAAAAGGACGACAACGCCCGCCTCTCGGTCCGCCTC
ACCGGCACGGAGAAGCAGCGCGACGACGCGCTCGAGGCCCTCGTCCTGCAGCAGGAGATCGCCGAGGAGCTCGAG
CGCGAGCGCAAGCGGAACAAGAAGGAGCTCTCCCAGCTCCACCACACCAACAGCACCATCCTCCGCCAGCGCGAC
GAGGCCCGCCGCGTCGTCCTCCACCTGCGCAGCCTGATCGGCGGCCAGAGCCACCACATGGAGCACCTGATCCAG
TCCCTCACCAAGCCCGACGAGCTGGCGCAGGAGATCGGCCAGAGCCTCGACGGCGAGGAGGACGAGGCCGACGAC
GCGGCGACGGTCGACGGCAAGGGCTCCGTCAAGTCGGCGGCACACGTCAGCAAGCGCCTCTCGTCGCTCGCCTTC
TTCGACGTCGCCGACCGCCACCTCAAGGACAAGACGGACGCCATCGCCCACATCGTCCGCAACATCGCGGACCAG
TGCCAGGCCGCCGTCGAGGGCCTGCAGCTGGCCCAGGACGCCGAGACGCGCTCGCTGCGGCGCCAGAGCAACCTG
TCCGCCGCCCCGAGCGAGGACGGCACCGACGACCGGTCCGTCGCCACCACCGAGGCCGGCGACGACGGCCGGCCC
CAGCACAGCTCCGGCCGCACCTCGAGCATCCCCCCGACGCCGGACCTGATCCCCAACCGCAGCAGCACTGCCATG
TCGTTCGCGTCCGCGACGACCACCCCCGAGCGGTCCAGCCAGCAGTATGCCGTGGGCGGCGACATCCCCACCAAG
ATCGTCGAGGACGACGAGGAGGTGTTTGAGGAGAACCGGAGCGACAACAGCGCCGGCCCCAACGAGAACGGAGTC
GTCGCCAAGCACGCTCCCGAGAGTCTGCTCCACCGGCCCTCGGGCGCGAGGATCAGCGCCCTCGGCGGTTCCCGA
TAG
Gene >Hirsu2|3960
ATGCCTCCCTCCCTCGGCACCCATCCGTCCCTGACTCGCCCGCGCACCGGCGACCGCGATGGCCGTCCCAGCACC
CGCGACCAGGGCGCCAACGACACCATGCTCATCCCCAGCCGCACCTCGTCGCTGCACTCGCGCATCACCCAGCCC
ATCCCCTCGACCCTCACCGCCAAGCCCCAGCAGCGCACCCCCAAGACGCTCACGCATGCCTACATGGTCTGCGGC
GTCGGCCGCGAGCCGTCCCAATGGGTCAAGGCGCCCGCCCCCGTCCAGGGCAAGATCGGCCACATGAAGGGCGCC
GTCGGCCAGTTCTGGCTGCCCGAGATCCTCGGCAGCAGCCCTCGCCTCGAGCAGGACAACGAGGTGGCCCGCGCC
CTCCACGCCGCCATGAGGGTGAGAAGGGCCCGTCCAATCTTGACATCTACTCCTCTCGACTGACCACCATTCTTG
CCCAGGCCTGCTTCCCCCACGACGTCGAGATCTGCACGGGCCGCAGCCAGCCTCACTGCGTCCACCATGCCTTCG
TCCTCCAGCAGGACTCCTCCCACACCCTCTACGGCATCTGCCTGCGCGTCTGGTCCCGCGCCGACGACAAGCGGG
CCGAGACGATCCGCGACCTGCGCAAGCGCACCGAGCCCGACTTTTACGACAACGCCGACGAGACGTACTGGATAC
CCTACTGCCTCTCCTTCCTCTCCCGCTACCCCCTCTACAACCTCCTCGGCGACTACCTCCGCGGCATGTGGATTC
ACTGGAACAAGGCCACCAACCTCTTCCACGCCGAGGAGGTCTCGCGCATCCTCAGCTTCCCCGCCCCGCGCCTCA
ATGACCTGGTCCGCATCGACATGAAGGACTACGCCCTCTGCTACCAGTTCCCCTCGTCGCCCACCGGCTTCCAGA
ACTTCGCCCTCTGGCCCCTCTTCACCTGCCTCTCCATCCCCAACATCGTCGGCGTCGTCGAGGCCGCCATCTCCC
CGACCCGCCGCATCATCTTCGTCAGCCACTACCCGGCCATGCTCACCGTCGCCGCCGAGACGGTCCGCTACTGCG
TCCGCGTCTACGAGTGGAGCGGCCTGTACGTGCCCGTCGTCCACGCCCGCCACGCCCAGGAGCTCGTCCAGGAGC
CCGGGCCCTACATCCTCGGCATCACCGCCGAGTGCCGCTCGCTCTTCACCGCCCCCACCGACGCCCTCGTCGTCG
ACCTCGACCGCAACTTCGTCCTCACCTCGAGCCCGCCCACCGCCCTGACGCCCAACCAGCGCAACAAGTTCGTCA
CCCGCCTCACCCAGGCCCTCAACGGCGACGTCACCCCGTCCGGCGTGCCCCAGCACCTGCGCTCCGCCTACGGCG
GCGGCAAGCTGGTCCCGGCCGGTCCCATCATCGTCGAGCGCGGCCAGGTCGAGTCGATCCAGGACCCCGAGTGGT
GGAACCAGGACTCCGTCATGGCCGTCATGGACCACGTCTGCGAGAAGCTCGGCCGCAACTCGGGCATCAAGGCCG
TCTTCGGCGGCTCCGTCAAGAAGCCCCTCATGACAAAGGTCTCGATGCGCCACCTCAACGAGATCGTCCGCGAGA
GGAACCAGTACTCCCGCGACGCCCTCGAGGCCTGGCAGGACTTCATCAACCTCAAGGGCCGCATGGACACGGAGC
TCAGCAAGGTCAACAAGCGCAACAACTACCTCGTCGAGGAGCTCGAGAGCTGGAAGCAGCAGTTCCTCAAGTTCC
AGGCCTTCGCGGAGCAGCTCACCAAGGAGACGCAGGACCTCAAGGTCAAGATCGAGAACCACAAGAGGGAGAACC
GCCGCCTGACGGGCCTCATCGACCAGCAAAAGGACGACAACGCCCGCCTCTCGGTCCGCCTCACCGGCACGGAGA
AGCAGCGCGACGACGCGCTCGAGGCCCTCGTCCTGCAGCAGGAGATCGCCGAGGAGCTCGAGCGCGAGCGCAAGC
GGAACAAGAAGGAGCTCTCCCAGCTCCACCACACCAACAGCACCATCCTCCGCCAGCGCGACGAGGCCCGCCGCG
TCGTCCTCCACCTGCGCAGCCTGATCGGCGGCCAGAGCCACCACATGGAGCACCTGATCCAGTCCCTCACCAAGC
CCGACGAGCTGGCGCAGGAGATCGGCCAGAGCCTCGACGGCGAGGAGGACGAGGCCGACGACGCGGCGACGGTCG
ACGGCAAGGGCTCCGTCAAGTCGGCGGCACACGTCAGCAAGCGCCTCTCGTCGCTCGCCTTCTTCGACGTCGCCG
ACCGCCACCTCAAGGACAAGACGGACGCCATCGCCCACATCGTCCGCAACATCGCGGACCAGTGCCAGGCCGCCG
TCGAGGGCCTGCAGCTGGCCCAGGACGCCGAGACGCGCTCGCTGCGGCGCCAGAGCAACCTGTCCGCCGCCCCGA
GCGAGGACGGCACCGACGACCGGTCCGTCGCCACCACCGAGGCCGGCGACGACGGCCGGCCCCAGCACAGCTCCG
GCCGCACCTCGAGCATCCCCCCGACGCCGGACCTGATCCCCAACCGCAGCAGCACTGCCATGTCGTTCGCGTCCG
CGACGACCACCCCCGAGCGGTCCAGCCAGCAGTATGCCGTGGGCGGCGACATCCCCACCAAGATCGTCGAGGACG
ACGAGGAGGTGTTTGAGGAGAACCGGAGCGACAACAGCGCCGGCCCCAACGAGAACGGAGTCGTCGCCAAGCACG
CTCCCGAGAGTCTGCTCCACCGGCCCTCGGGCGCGAGGATCAGCGCCCTCGGCGGTTCCCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail