Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3951
Gene name
LocationContig_207:8941..11236
Strand+
Gene length (bp)2295
Transcript length (bp)2295
Coding sequence length (bp)2295
Protein length (aa) 765

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03152 UFD1 Ubiquitin fusion degradation protein UFD1 6.7E-14 154 239
PF16558 AZUL Amino-terminal Zinc-binding domain of ubiquitin ligase E3A 1.1E-06 651 691

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q19584|UFD1_CAEEL Ubiquitin fusion degradation protein 1 homolog OS=Caenorhabditis elegans GN=ufd-1 PE=3 SV=1 52 239 3.0E-11
sp|P53044|UFD1_YEAST Ubiquitin fusion degradation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD1 PE=1 SV=1 83 248 5.0E-09
sp|Q58D05|TRAD1_BOVIN TRAF-type zinc finger domain-containing protein 1 OS=Bos taurus GN=TRAFD1 PE=2 SV=1 422 576 3.0E-08
sp|O14545|TRAD1_HUMAN TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens GN=TRAFD1 PE=1 SV=1 422 576 2.0E-06
sp|Q4R970|TRAD1_MACFA TRAF-type zinc finger domain-containing protein 1 OS=Macaca fascicularis GN=TRAFD1 PE=2 SV=1 422 576 4.0E-06

GO

GO Term Description Terminal node
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0006508 proteolysis No
GO:0044265 cellular macromolecule catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008150 biological_process No
GO:0044248 cellular catabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0051603 proteolysis involved in cellular protein catabolic process No
GO:0009987 cellular process No
GO:0019941 modification-dependent protein catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0019538 protein metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0009056 catabolic process No
GO:0009057 macromolecule catabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3951
MDDLPPLRWSGTYAAPPPAFGASRPLPGDKIVLPQSALEQLLAAAHSRQPPGTSFTSFDPQDRYTSNFYGGGSQQ
ESSQQLPHPLTFRLVNPINSKSVYAGIREFSAPEGTLGLSPFLSETLGIDSIEKLPEDEASPGRPHNATDDGATT
PFRQIAVLAQQLPKGTYVRLRPLEAGYNPDDWKSLLERHLRENFTCLTKDAVLSVPGVQGETFKFLVDKFAPEGD
GICVVDTDLEVDIEALNEEQARETMRQIMSKAQSGLTNGSSEGGELDIWKDVQGQVSPGDYVDYNLPSWNRSQPL
AITLSNIEREDSLDVFVNPKSSQHRTLPRDSTHVFGNFGPADQGSKTICIAPTNAELDGAEGILVSVRAYRSKRA
PEPSSDPVSYTIRVKAASFSGHANGRRDGAEDGSGEGVGAGPNDEQCKNCFQYVPKRTVVLHENFCRRNNVVCAR
CKSVFKKGSPDWESHWHCEHDDAHGNTTLGKAKHDEVFHTDRQCPSCEFSTNSLPDLSRHRTTVCPGKLILCRFC
HLEVPQEGDPFNPSPEVILSGMTAHELADGARTTECHLCDKIVRLRDMETHLKHHELDKGYRSKPAICRNINCGR
TQHGVGPKGRIGAGTAQGQGPGNDIGLCSLCFGPLYVSMHDPEGKALRRRIERRYLGQMMTGCGKPHCANEWCKT
GRANGGLDPKASSAQAVLPLVKPLLENIPRHDEPMFFCVDEAGQKSRAVAEMLAAEKGWDLEWCVAAAEAEKSSA
DRMRDWLQAWAPRK*
Coding >Hirsu2|3951
ATGGATGACCTTCCGCCTCTTCGTTGGTCCGGCACATATGCCGCCCCTCCTCCCGCCTTCGGCGCTTCGAGGCCC
CTCCCGGGTGACAAGATCGTCCTTCCTCAGTCGGCTCTCGAGCAGCTTCTCGCCGCCGCACACTCCCGCCAACCA
CCTGGCACCTCCTTCACCTCATTCGACCCTCAGGATAGATACACTTCGAACTTCTATGGAGGCGGCTCGCAACAG
GAAAGCAGCCAGCAGCTTCCCCACCCCCTCACGTTTCGTCTAGTGAATCCCATCAACAGCAAATCCGTATACGCT
GGTATCCGGGAGTTCTCCGCCCCGGAAGGGACGTTGGGCCTCAGCCCCTTTCTGTCGGAAACTCTGGGTATCGAT
TCGATAGAAAAGCTGCCTGAGGATGAAGCGAGTCCCGGTCGCCCTCACAATGCCACCGACGATGGTGCAACCACT
CCATTCCGACAGATCGCAGTCCTCGCGCAACAGCTACCCAAGGGAACGTACGTCCGTTTACGGCCCCTCGAGGCG
GGCTACAATCCAGACGACTGGAAATCCCTGTTGGAGCGTCATCTGAGAGAAAACTTCACTTGCCTCACCAAAGAT
GCCGTCCTCTCCGTCCCAGGAGTTCAGGGTGAAACGTTCAAGTTCTTGGTCGATAAATTTGCGCCCGAGGGTGAC
GGCATATGTGTTGTCGACACCGACCTCGAGGTGGACATCGAGGCTCTCAACGAAGAACAGGCCAGGGAGACGATG
CGCCAGATCATGTCAAAGGCGCAGTCGGGACTCACGAACGGAAGCTCCGAGGGCGGCGAGCTGGACATATGGAAG
GACGTCCAAGGGCAGGTCTCGCCCGGGGACTACGTCGACTACAATCTGCCGTCGTGGAATCGATCGCAGCCTCTA
GCCATCACGCTCAGCAATATCGAGCGAGAGGACAGCCTGGACGTCTTTGTTAATCCCAAGTCATCTCAGCATCGG
ACCTTGCCTCGCGACTCGACGCATGTCTTTGGAAACTTTGGCCCCGCCGATCAAGGCTCCAAGACGATATGTATC
GCTCCCACCAACGCTGAGCTGGATGGCGCAGAAGGCATCCTTGTTTCGGTTCGCGCGTACCGAAGCAAGAGAGCA
CCGGAGCCGTCGTCGGACCCGGTCTCGTACACGATCCGGGTCAAAGCGGCGTCCTTTTCCGGTCATGCCAACGGT
AGACGGGACGGGGCCGAGGACGGTTCGGGTGAGGGTGTGGGCGCAGGCCCAAATGACGAGCAATGCAAGAACTGC
TTCCAGTATGTGCCCAAGCGGACGGTTGTTCTACACGAAAACTTTTGCCGCAGAAATAACGTCGTGTGCGCGCGG
TGTAAGTCTGTCTTCAAAAAGGGGTCTCCCGATTGGGAATCGCATTGGCACTGCGAACACGACGATGCCCACGGA
AACACAACATTGGGCAAGGCCAAGCACGATGAAGTTTTTCACACAGACCGCCAGTGTCCCTCGTGCGAATTTTCC
ACAAACTCGCTACCGGACCTCTCGAGACATCGAACGACGGTCTGCCCCGGCAAGCTGATCTTGTGTCGATTTTGT
CACCTAGAAGTTCCTCAAGAAGGAGACCCATTCAACCCGTCTCCCGAAGTCATACTGTCTGGGATGACGGCGCAC
GAACTTGCGGACGGGGCACGCACCACGGAGTGCCATCTTTGCGATAAGATCGTCCGTCTCCGAGACATGGAGACC
CATCTCAAGCATCACGAGCTGGACAAGGGCTACCGCTCGAAGCCCGCGATCTGTCGCAACATCAACTGCGGCAGG
ACTCAGCATGGTGTGGGGCCCAAAGGCCGTATCGGCGCGGGGACGGCTCAAGGCCAGGGGCCGGGCAACGACATC
GGACTCTGCTCGCTGTGCTTCGGGCCCCTTTACGTGAGCATGCACGACCCCGAAGGCAAGGCGCTTCGGAGGAGG
ATCGAGAGACGGTATCTCGGTCAGATGATGACGGGGTGCGGAAAGCCTCACTGCGCCAATGAATGGTGCAAGACA
GGCAGAGCCAACGGCGGTCTCGACCCCAAGGCATCGTCTGCCCAAGCAGTTTTGCCCCTGGTGAAACCCCTACTC
GAAAATATCCCGAGACATGACGAACCGATGTTCTTCTGCGTCGACGAGGCCGGGCAGAAGAGCCGGGCGGTGGCC
GAGATGCTCGCTGCCGAGAAGGGATGGGACCTGGAGTGGTGCGTCGCGGCCGCCGAAGCGGAGAAGAGCAGTGCG
GACAGGATGAGAGACTGGCTGCAGGCATGGGCTCCAAGGAAATAG
Transcript >Hirsu2|3951
ATGGATGACCTTCCGCCTCTTCGTTGGTCCGGCACATATGCCGCCCCTCCTCCCGCCTTCGGCGCTTCGAGGCCC
CTCCCGGGTGACAAGATCGTCCTTCCTCAGTCGGCTCTCGAGCAGCTTCTCGCCGCCGCACACTCCCGCCAACCA
CCTGGCACCTCCTTCACCTCATTCGACCCTCAGGATAGATACACTTCGAACTTCTATGGAGGCGGCTCGCAACAG
GAAAGCAGCCAGCAGCTTCCCCACCCCCTCACGTTTCGTCTAGTGAATCCCATCAACAGCAAATCCGTATACGCT
GGTATCCGGGAGTTCTCCGCCCCGGAAGGGACGTTGGGCCTCAGCCCCTTTCTGTCGGAAACTCTGGGTATCGAT
TCGATAGAAAAGCTGCCTGAGGATGAAGCGAGTCCCGGTCGCCCTCACAATGCCACCGACGATGGTGCAACCACT
CCATTCCGACAGATCGCAGTCCTCGCGCAACAGCTACCCAAGGGAACGTACGTCCGTTTACGGCCCCTCGAGGCG
GGCTACAATCCAGACGACTGGAAATCCCTGTTGGAGCGTCATCTGAGAGAAAACTTCACTTGCCTCACCAAAGAT
GCCGTCCTCTCCGTCCCAGGAGTTCAGGGTGAAACGTTCAAGTTCTTGGTCGATAAATTTGCGCCCGAGGGTGAC
GGCATATGTGTTGTCGACACCGACCTCGAGGTGGACATCGAGGCTCTCAACGAAGAACAGGCCAGGGAGACGATG
CGCCAGATCATGTCAAAGGCGCAGTCGGGACTCACGAACGGAAGCTCCGAGGGCGGCGAGCTGGACATATGGAAG
GACGTCCAAGGGCAGGTCTCGCCCGGGGACTACGTCGACTACAATCTGCCGTCGTGGAATCGATCGCAGCCTCTA
GCCATCACGCTCAGCAATATCGAGCGAGAGGACAGCCTGGACGTCTTTGTTAATCCCAAGTCATCTCAGCATCGG
ACCTTGCCTCGCGACTCGACGCATGTCTTTGGAAACTTTGGCCCCGCCGATCAAGGCTCCAAGACGATATGTATC
GCTCCCACCAACGCTGAGCTGGATGGCGCAGAAGGCATCCTTGTTTCGGTTCGCGCGTACCGAAGCAAGAGAGCA
CCGGAGCCGTCGTCGGACCCGGTCTCGTACACGATCCGGGTCAAAGCGGCGTCCTTTTCCGGTCATGCCAACGGT
AGACGGGACGGGGCCGAGGACGGTTCGGGTGAGGGTGTGGGCGCAGGCCCAAATGACGAGCAATGCAAGAACTGC
TTCCAGTATGTGCCCAAGCGGACGGTTGTTCTACACGAAAACTTTTGCCGCAGAAATAACGTCGTGTGCGCGCGG
TGTAAGTCTGTCTTCAAAAAGGGGTCTCCCGATTGGGAATCGCATTGGCACTGCGAACACGACGATGCCCACGGA
AACACAACATTGGGCAAGGCCAAGCACGATGAAGTTTTTCACACAGACCGCCAGTGTCCCTCGTGCGAATTTTCC
ACAAACTCGCTACCGGACCTCTCGAGACATCGAACGACGGTCTGCCCCGGCAAGCTGATCTTGTGTCGATTTTGT
CACCTAGAAGTTCCTCAAGAAGGAGACCCATTCAACCCGTCTCCCGAAGTCATACTGTCTGGGATGACGGCGCAC
GAACTTGCGGACGGGGCACGCACCACGGAGTGCCATCTTTGCGATAAGATCGTCCGTCTCCGAGACATGGAGACC
CATCTCAAGCATCACGAGCTGGACAAGGGCTACCGCTCGAAGCCCGCGATCTGTCGCAACATCAACTGCGGCAGG
ACTCAGCATGGTGTGGGGCCCAAAGGCCGTATCGGCGCGGGGACGGCTCAAGGCCAGGGGCCGGGCAACGACATC
GGACTCTGCTCGCTGTGCTTCGGGCCCCTTTACGTGAGCATGCACGACCCCGAAGGCAAGGCGCTTCGGAGGAGG
ATCGAGAGACGGTATCTCGGTCAGATGATGACGGGGTGCGGAAAGCCTCACTGCGCCAATGAATGGTGCAAGACA
GGCAGAGCCAACGGCGGTCTCGACCCCAAGGCATCGTCTGCCCAAGCAGTTTTGCCCCTGGTGAAACCCCTACTC
GAAAATATCCCGAGACATGACGAACCGATGTTCTTCTGCGTCGACGAGGCCGGGCAGAAGAGCCGGGCGGTGGCC
GAGATGCTCGCTGCCGAGAAGGGATGGGACCTGGAGTGGTGCGTCGCGGCCGCCGAAGCGGAGAAGAGCAGTGCG
GACAGGATGAGAGACTGGCTGCAGGCATGGGCTCCAAGGAAATAG
Gene >Hirsu2|3951
ATGGATGACCTTCCGCCTCTTCGTTGGTCCGGCACATATGCCGCCCCTCCTCCCGCCTTCGGCGCTTCGAGGCCC
CTCCCGGGTGACAAGATCGTCCTTCCTCAGTCGGCTCTCGAGCAGCTTCTCGCCGCCGCACACTCCCGCCAACCA
CCTGGCACCTCCTTCACCTCATTCGACCCTCAGGATAGATACACTTCGAACTTCTATGGAGGCGGCTCGCAACAG
GAAAGCAGCCAGCAGCTTCCCCACCCCCTCACGTTTCGTCTAGTGAATCCCATCAACAGCAAATCCGTATACGCT
GGTATCCGGGAGTTCTCCGCCCCGGAAGGGACGTTGGGCCTCAGCCCCTTTCTGTCGGAAACTCTGGGTATCGAT
TCGATAGAAAAGCTGCCTGAGGATGAAGCGAGTCCCGGTCGCCCTCACAATGCCACCGACGATGGTGCAACCACT
CCATTCCGACAGATCGCAGTCCTCGCGCAACAGCTACCCAAGGGAACGTACGTCCGTTTACGGCCCCTCGAGGCG
GGCTACAATCCAGACGACTGGAAATCCCTGTTGGAGCGTCATCTGAGAGAAAACTTCACTTGCCTCACCAAAGAT
GCCGTCCTCTCCGTCCCAGGAGTTCAGGGTGAAACGTTCAAGTTCTTGGTCGATAAATTTGCGCCCGAGGGTGAC
GGCATATGTGTTGTCGACACCGACCTCGAGGTGGACATCGAGGCTCTCAACGAAGAACAGGCCAGGGAGACGATG
CGCCAGATCATGTCAAAGGCGCAGTCGGGACTCACGAACGGAAGCTCCGAGGGCGGCGAGCTGGACATATGGAAG
GACGTCCAAGGGCAGGTCTCGCCCGGGGACTACGTCGACTACAATCTGCCGTCGTGGAATCGATCGCAGCCTCTA
GCCATCACGCTCAGCAATATCGAGCGAGAGGACAGCCTGGACGTCTTTGTTAATCCCAAGTCATCTCAGCATCGG
ACCTTGCCTCGCGACTCGACGCATGTCTTTGGAAACTTTGGCCCCGCCGATCAAGGCTCCAAGACGATATGTATC
GCTCCCACCAACGCTGAGCTGGATGGCGCAGAAGGCATCCTTGTTTCGGTTCGCGCGTACCGAAGCAAGAGAGCA
CCGGAGCCGTCGTCGGACCCGGTCTCGTACACGATCCGGGTCAAAGCGGCGTCCTTTTCCGGTCATGCCAACGGT
AGACGGGACGGGGCCGAGGACGGTTCGGGTGAGGGTGTGGGCGCAGGCCCAAATGACGAGCAATGCAAGAACTGC
TTCCAGTATGTGCCCAAGCGGACGGTTGTTCTACACGAAAACTTTTGCCGCAGAAATAACGTCGTGTGCGCGCGG
TGTAAGTCTGTCTTCAAAAAGGGGTCTCCCGATTGGGAATCGCATTGGCACTGCGAACACGACGATGCCCACGGA
AACACAACATTGGGCAAGGCCAAGCACGATGAAGTTTTTCACACAGACCGCCAGTGTCCCTCGTGCGAATTTTCC
ACAAACTCGCTACCGGACCTCTCGAGACATCGAACGACGGTCTGCCCCGGCAAGCTGATCTTGTGTCGATTTTGT
CACCTAGAAGTTCCTCAAGAAGGAGACCCATTCAACCCGTCTCCCGAAGTCATACTGTCTGGGATGACGGCGCAC
GAACTTGCGGACGGGGCACGCACCACGGAGTGCCATCTTTGCGATAAGATCGTCCGTCTCCGAGACATGGAGACC
CATCTCAAGCATCACGAGCTGGACAAGGGCTACCGCTCGAAGCCCGCGATCTGTCGCAACATCAACTGCGGCAGG
ACTCAGCATGGTGTGGGGCCCAAAGGCCGTATCGGCGCGGGGACGGCTCAAGGCCAGGGGCCGGGCAACGACATC
GGACTCTGCTCGCTGTGCTTCGGGCCCCTTTACGTGAGCATGCACGACCCCGAAGGCAAGGCGCTTCGGAGGAGG
ATCGAGAGACGGTATCTCGGTCAGATGATGACGGGGTGCGGAAAGCCTCACTGCGCCAATGAATGGTGCAAGACA
GGCAGAGCCAACGGCGGTCTCGACCCCAAGGCATCGTCTGCCCAAGCAGTTTTGCCCCTGGTGAAACCCCTACTC
GAAAATATCCCGAGACATGACGAACCGATGTTCTTCTGCGTCGACGAGGCCGGGCAGAAGAGCCGGGCGGTGGCC
GAGATGCTCGCTGCCGAGAAGGGATGGGACCTGGAGTGGTGCGTCGCGGCCGCCGAAGCGGAGAAGAGCAGTGCG
GACAGGATGAGAGACTGGCTGCAGGCATGGGCTCCAAGGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail