Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3946
Gene name
LocationContig_2069:3321..3786
Strand-
Gene length (bp)465
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 1.6E-13 41 147

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 39 141 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 38 57 19
2 116 138 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3946
MVAGHMPGICLTFGLYETFKAALLRRRGAQPADARQQLRASALGAFAAGGLSSWFFVPIDVVKTRMRLSAGDRIE
TPPSSGPAATGTRHSPLRSSPPDPNGAIGIARDVLRREGVAGLFRGSILTVIASALTSGLYIGCYEAGKLYLGEV
RESG*
Coding >Hirsu2|3946
ATGGTGGCCGGCCACATGCCCGGCATCTGCCTGACCTTTGGCCTCTACGAGACCTTCAAGGCGGCCCTGCTGCGG
AGGAGGGGCGCGCAGCCGGCCGATGCGCGGCAGCAGCTGAGGGCCAGCGCGCTGGGCGCCTTTGCCGCCGGCGGC
CTCTCCTCCTGGTTCTTCGTCCCCATCGACGTGGTGAAGACGAGGATGAGGCTCTCGGCCGGCGACCGGATCGAG
ACGCCGCCGAGCTCTGGCCCCGCGGCCACGGGGACGAGGCACTCGCCGCTTCGATCCTCGCCCCCGGATCCCAAC
GGCGCCATCGGCATCGCGAGAGACGTGCTCCGCAGGGAGGGGGTGGCCGGTCTGTTCAGGGGGTCTATACTGACT
GTGATTGCTTCGGCCCTTACCAGCGGGCTGTACATAGGCTGTTACGAGGCCGGCAAGCTTTATCTCGGCGAGGTC
AGAGAATCCGGGTGA
Transcript >Hirsu2|3946
ATGGTGGCCGGCCACATGCCCGGCATCTGCCTGACCTTTGGCCTCTACGAGACCTTCAAGGCGGCCCTGCTGCGG
AGGAGGGGCGCGCAGCCGGCCGATGCGCGGCAGCAGCTGAGGGCCAGCGCGCTGGGCGCCTTTGCCGCCGGCGGC
CTCTCCTCCTGGTTCTTCGTCCCCATCGACGTGGTGAAGACGAGGATGAGGCTCTCGGCCGGCGACCGGATCGAG
ACGCCGCCGAGCTCTGGCCCCGCGGCCACGGGGACGAGGCACTCGCCGCTTCGATCCTCGCCCCCGGATCCCAAC
GGCGCCATCGGCATCGCGAGAGACGTGCTCCGCAGGGAGGGGGTGGCCGGTCTGTTCAGGGGGTCTATACTGACT
GTGATTGCTTCGGCCCTTACCAGCGGGCTGTACATAGGCTGTTACGAGGCCGGCAAGCTTTATCTCGGCGAGGTC
AGAGAATCCGGGTGA
Gene >Hirsu2|3946
ATGGTGGCCGGCCACATGCCCGGCATCTGCCTGACCTTTGGCCTCTACGAGACCTTCAAGGCGGCCCTGCTGCGG
AGGAGGGGCGCGCAGCCGGCCGATGCGCGGCAGCAGCTGAGGGCCAGCGCGCTGGGCGCCTTTGCCGCCGGCGGC
CTCTCCTCCTGGTTCTTCGTCCCCATCGACGTGGTGAAGACGAGGATGAGGCTCTCGGCCGGCGACCGGATCGAG
ACGCCGCCGAGCTCTGGCCCCGCGGCCACGGGGACGAGGCACTCGCCGCTTCGATCCTCGCCCCCGGATCCCAAC
GGCGCCATCGGCATCGCGAGAGACGTGCTCCGCAGGGAGGGGGTGGCCGGTCTGTTCAGGGGGTCTATACTGACT
GTGATTGCTTCGGCCCTTACCAGCGGGCTGTACATAGGCTGTTACGAGGCCGGCAAGCTTTATCTCGGCGAGGTC
AGAGAATCCGGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail