Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3943
Gene name
LocationContig_2067:904..3000
Strand-
Gene length (bp)2096
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 1.4E-41 252 550

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53154|GUP1_YEAST Glycerol uptake protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP1 PE=1 SV=1 1 606 6.0E-163
sp|Q09758|YA71_SCHPO Putative membrane-bound O-acyltransferase C24H6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.01c PE=3 SV=4 48 606 2.0E-134
sp|Q08929|GUP2_YEAST Glycerol uptake protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP2 PE=3 SV=1 48 606 1.0E-132
sp|Q5VTY9|HHAT_HUMAN Protein-cysteine N-palmitoyltransferase HHAT OS=Homo sapiens GN=HHAT PE=1 SV=1 301 490 3.0E-12
sp|Q8BMT9|HHAT_MOUSE Protein-cysteine N-palmitoyltransferase HHAT OS=Mus musculus GN=Hhat PE=2 SV=1 300 500 8.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53154|GUP1_YEAST Glycerol uptake protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP1 PE=1 SV=1 1 606 6.0E-163
sp|Q09758|YA71_SCHPO Putative membrane-bound O-acyltransferase C24H6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.01c PE=3 SV=4 48 606 2.0E-134
sp|Q08929|GUP2_YEAST Glycerol uptake protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP2 PE=3 SV=1 48 606 1.0E-132
sp|Q5VTY9|HHAT_HUMAN Protein-cysteine N-palmitoyltransferase HHAT OS=Homo sapiens GN=HHAT PE=1 SV=1 301 490 3.0E-12
sp|Q8BMT9|HHAT_MOUSE Protein-cysteine N-palmitoyltransferase HHAT OS=Mus musculus GN=Hhat PE=2 SV=1 300 500 8.0E-11
sp|Q51392|ALGI_PSEAE Probable alginate O-acetylase AlgI OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=algI PE=3 SV=2 312 522 1.0E-07
sp|P59789|ALGI_PSEFL Probable alginate O-acetylase AlgI OS=Pseudomonas fluorescens GN=algI PE=3 SV=1 311 600 2.0E-07
sp|O52196|ALGI_AZOVI Probable alginate O-acetylase AlgI OS=Azotobacter vinelandii GN=algI PE=3 SV=1 312 522 4.0E-07
sp|Q887Q6|ALGI_PSESM Probable alginate O-acetylase AlgI OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=algI PE=3 SV=1 311 500 3.0E-06
sp|Q88ND2|ALGI_PSEPK Probable alginate O-acetylase AlgI OS=Pseudomonas putida (strain KT2440) GN=algI PE=3 SV=1 311 535 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.5

Transmembrane Domains

Domain # Start End Length
1 57 76 19
2 164 186 22
3 245 267 22
4 314 336 22
5 357 376 19
6 386 408 22
7 475 492 17
8 497 519 22
9 532 554 22
10 569 591 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3943
MDQLSFLRKVYDLDTLDTRFTSSSTVPYQTVIDGRADAATAKPRPRAQPAKWRTAEFYVYYVVFVLVVPYMFWIA
YDVSRPSDPRYAKYEKFLSDGWIPGRKVDVSDPQYHTFRQNLPYMAALLVLHPALRAAWNAVHPLPGGGDDRQRG
RARLDQRASFDARFALFFLLALHGVSAFKVLAILYLNYRVATELPRRYVPAATWLFNVATLFANELCDGYQLRVL
AGRVAPADSAAVRWGAWLDGYGGLISRWEVLFNISILRLISFNMDYYWSMDKRGADALEKKQLDPAGLSERDRIT
MPAEAGDFSFRNYLAYAVYAPLYLAGPILTFNDYAWQLRHRAASIERGRTARYAVRFLLVLLAMELVLHFDYVGA
IGKASPAWGEYTAAQLSLLSYFNLHIIWLKLLLPWRLFRLWALADGVDPPENMVRCVSDNYSTQLFWRAWHRSYN
RWLIRYLYVPLGGASLRSWRAAARSVLTYLLVFTFVALWHDIQLRLLVWGWLVVLFMLPEWAAAWLFPPRRWEGR
PTAYRMLCCVGAVANVLMMMAANLVGFAVGLDGLESIVKGILRDWSGLLFLVVACSCLFVGIQVMFEIRESEKRK
GVTLRC*
Coding >Hirsu2|3943
ATGGACCAGCTGTCGTTCCTGCGCAAGGTCTACGACCTCGACACGCTCGACACGCGCTTCACCAGCTCGTCGACC
GTGCCCTACCAGACCGTCATCGATGGCCGGGCCGACGCGGCGACGGCCAAGCCCCGGCCGCGGGCGCAGCCGGCC
AAGTGGCGCACCGCCGAGTTCTACGTCTACTACGTCGTCTTCGTCCTCGTCGTGCCCTACATGTTCTGGATCGCG
TACGACGTCTCGCGCCCCTCGGACCCGCGCTACGCCAAGTACGAAAAGTTCCTGTCGGACGGCTGGATCCCCGGG
CGCAAGGTCGACGTCTCGGACCCGCAGTACCACACGTTCCGCCAGAACCTGCCGTACATGGCGGCCCTGCTCGTG
CTGCACCCGGCGCTGAGGGCGGCGTGGAACGCCGTGCACCCGCTGCCCGGCGGCGGCGACGACCGGCAGCGGGGC
CGGGCCCGGCTCGACCAGCGGGCCTCGTTCGACGCCCGCTTCGCCCTCTTCTTCCTGCTCGCCCTGCACGGCGTG
TCGGCCTTCAAGGTGCTGGCCATCCTCTACCTCAACTACCGGGTCGCGACGGAGCTGCCGAGGCGCTACGTGCCC
GCCGCCACCTGGCTCTTCAACGTCGCGACCCTGTTCGCCAACGAGCTGTGCGACGGCTACCAGCTGCGCGTCCTG
GCCGGCCGCGTCGCGCCCGCCGACTCGGCGGCCGTGCGCTGGGGCGCCTGGCTCGACGGCTACGGCGGGCTCATC
TCCCGCTGGGAGGTGCTCTTCAACATCAGCATCCTCCGCCTCATCAGCTTCAACATGGACTACTACTGGAGCATG
GACAAGCGCGGCGCCGACGCGCTCGAGAAGAAGCAGCTGGACCCGGCCGGGCTCTCGGAGCGGGACCGGATCACG
ATGCCGGCCGAGGCGGGCGACTTCAGCTTCCGCAACTACCTGGCCTACGCCGTCTACGCGCCGCTGTACTTGGCC
GGGCCGATCCTGACGTTCAACGACTACGCGTGGCAGCTGCGGCACCGGGCGGCCAGCATCGAGCGCGGGCGCACG
GCCCGCTACGCCGTCCGCTTCCTGCTCGTGCTGCTGGCCATGGAGCTGGTGCTGCACTTCGACTACGTCGGCGCC
ATCGGCAAGGCCAGCCCGGCCTGGGGCGAGTACACGGCGGCGCAGCTGAGCCTGCTGTCCTACTTCAACCTGCAC
ATCATCTGGCTGAAGCTGCTGCTGCCGTGGCGCCTGTTCCGGCTGTGGGCGCTGGCGGACGGCGTCGACCCGCCC
GAGAACATGGTGCGCTGCGTCAGCGACAACTACAGCACCCAGCTCTTCTGGCGCGCCTGGCACCGCTCCTACAAC
CGCTGGCTGATCCGCTACCTGTACGTGCCGCTGGGCGGCGCCTCGCTGCGCAGCTGGCGCGCCGCCGCCCGCTCC
GTGCTGACCTACCTGCTCGTCTTCACCTTCGTCGCCCTCTGGCACGACATCCAGCTGCGCCTGCTCGTCTGGGGC
TGGCTCGTCGTCCTCTTCATGCTGCCGGAGTGGGCGGCCGCCTGGCTGTTCCCGCCGCGCCGCTGGGAGGGCCGC
CCGACGGCGTACCGCATGCTGTGCTGCGTCGGCGCCGTCGCCAACGTGCTGATGATGATGGCCGCCAACCTCGTC
GGCTTCGCCGTCGGCCTCGACGGCCTCGAGAGCATCGTCAAGGGCATCCTGCGGGACTGGTCAGGGCTCTTGTTC
CTCGTCGTCGCCTGCTCGTGCCTGTTCGTCGGCATCCAGGTCATGTTCGAGATTCGCGAGTCGGAGAAGAGGAAG
GGCGTGACGCTGAGGTGCTGA
Transcript >Hirsu2|3943
ATGGACCAGCTGTCGTTCCTGCGCAAGGTCTACGACCTCGACACGCTCGACACGCGCTTCACCAGCTCGTCGACC
GTGCCCTACCAGACCGTCATCGATGGCCGGGCCGACGCGGCGACGGCCAAGCCCCGGCCGCGGGCGCAGCCGGCC
AAGTGGCGCACCGCCGAGTTCTACGTCTACTACGTCGTCTTCGTCCTCGTCGTGCCCTACATGTTCTGGATCGCG
TACGACGTCTCGCGCCCCTCGGACCCGCGCTACGCCAAGTACGAAAAGTTCCTGTCGGACGGCTGGATCCCCGGG
CGCAAGGTCGACGTCTCGGACCCGCAGTACCACACGTTCCGCCAGAACCTGCCGTACATGGCGGCCCTGCTCGTG
CTGCACCCGGCGCTGAGGGCGGCGTGGAACGCCGTGCACCCGCTGCCCGGCGGCGGCGACGACCGGCAGCGGGGC
CGGGCCCGGCTCGACCAGCGGGCCTCGTTCGACGCCCGCTTCGCCCTCTTCTTCCTGCTCGCCCTGCACGGCGTG
TCGGCCTTCAAGGTGCTGGCCATCCTCTACCTCAACTACCGGGTCGCGACGGAGCTGCCGAGGCGCTACGTGCCC
GCCGCCACCTGGCTCTTCAACGTCGCGACCCTGTTCGCCAACGAGCTGTGCGACGGCTACCAGCTGCGCGTCCTG
GCCGGCCGCGTCGCGCCCGCCGACTCGGCGGCCGTGCGCTGGGGCGCCTGGCTCGACGGCTACGGCGGGCTCATC
TCCCGCTGGGAGGTGCTCTTCAACATCAGCATCCTCCGCCTCATCAGCTTCAACATGGACTACTACTGGAGCATG
GACAAGCGCGGCGCCGACGCGCTCGAGAAGAAGCAGCTGGACCCGGCCGGGCTCTCGGAGCGGGACCGGATCACG
ATGCCGGCCGAGGCGGGCGACTTCAGCTTCCGCAACTACCTGGCCTACGCCGTCTACGCGCCGCTGTACTTGGCC
GGGCCGATCCTGACGTTCAACGACTACGCGTGGCAGCTGCGGCACCGGGCGGCCAGCATCGAGCGCGGGCGCACG
GCCCGCTACGCCGTCCGCTTCCTGCTCGTGCTGCTGGCCATGGAGCTGGTGCTGCACTTCGACTACGTCGGCGCC
ATCGGCAAGGCCAGCCCGGCCTGGGGCGAGTACACGGCGGCGCAGCTGAGCCTGCTGTCCTACTTCAACCTGCAC
ATCATCTGGCTGAAGCTGCTGCTGCCGTGGCGCCTGTTCCGGCTGTGGGCGCTGGCGGACGGCGTCGACCCGCCC
GAGAACATGGTGCGCTGCGTCAGCGACAACTACAGCACCCAGCTCTTCTGGCGCGCCTGGCACCGCTCCTACAAC
CGCTGGCTGATCCGCTACCTGTACGTGCCGCTGGGCGGCGCCTCGCTGCGCAGCTGGCGCGCCGCCGCCCGCTCC
GTGCTGACCTACCTGCTCGTCTTCACCTTCGTCGCCCTCTGGCACGACATCCAGCTGCGCCTGCTCGTCTGGGGC
TGGCTCGTCGTCCTCTTCATGCTGCCGGAGTGGGCGGCCGCCTGGCTGTTCCCGCCGCGCCGCTGGGAGGGCCGC
CCGACGGCGTACCGCATGCTGTGCTGCGTCGGCGCCGTCGCCAACGTGCTGATGATGATGGCCGCCAACCTCGTC
GGCTTCGCCGTCGGCCTCGACGGCCTCGAGAGCATCGTCAAGGGCATCCTGCGGGACTGGTCAGGGCTCTTGTTC
CTCGTCGTCGCCTGCTCGTGCCTGTTCGTCGGCATCCAGGTCATGTTCGAGATTCGCGAGTCGGAGAAGAGGAAG
GGCGTGACGCTGAGGTGCTGA
Gene >Hirsu2|3943
ATGGACCAGCTGTCGTTCCTGCGCAAGGTCTACGACCTCGACACGCTCGACACGCGCTTCACCAGCTCGTCGACC
GTGCCCTACCAGACCGTCATCGATGGCCGGGCCGACGCGGCGACGGCCAAGCCCCGGCCGCGGGCGCAGCCGGCC
AAGTGGCGCACCGCCGAGTTCTACGTCTACTACGTCGTCTTCGTCCTCGTCGTGCCCTACATGTTCTGGATCGCG
TACGACGTCTCGCGCCGTGCGTTGCCGCCTCCCTCCCCCTCGTTTCGTCGTCGTCAAGGCGCCGTGCTGACGTCG
TCGCTCTCCGCGAGCCCGCAGCCTCGGACCCGCGCTACGCCAAGTACGAAAAGTTCCTGTCGGACGGCTGGATCC
CCGGGCGCAAGGTCGACGTCTCGGACCCGCAGTACCACACGTTCCGCCAGAACCTGCCGTACATGGCGGCCCTGC
TCGTGCTGCACCCGGCGCTGAGGGCGGCGTGGAACGCCGTGCACCCGCTGCCCGGCGGCGGCGACGACCGGCAGC
GGGGCCGGGCCCGGCTCGACCAGCGGGCCTCGTTCGACGCCCGCTTCGCCCTCTTCTTCCTGCTCGCCCTGCACG
GCGTGTCGGCCTTCAAGGTGCTGGCCATCCTCTACCTCAACTACCGGGTCGCGACGGAGCTGCCGAGGCGCTACG
TGCCCGCCGCCACCTGGCTCTTCAACGTCGCGACCCTGTTCGCCAACGAGCTGTGCGACGGCTACCAGCTGCGCG
TCCTGGCCGGCCGCGTCGCGCCCGCCGACTCGGCGGCCGTGCGCTGGGGCGCCTGGCTCGACGGCTACGGCGGGC
TCATCTCCCGCTGGGAGGTGCTCTTCAACATCAGCATCCTCCGCCTCATCAGCTTCAACATGGACTACTACTGGA
GCATGGACAAGCGCGGCGCCGACGCGCTCGAGGTGAGCAACGGGAGTGTGTGTGTGTGTGTGTGTGTGTGTGTGT
GTGTGCCCCTCGGCGCCCCGTTGCTAATACGTCCAAGAAGAAGCAGCTGGACCCGGCCGGGCTCTCGGAGCGGGA
CCGGATCACGATGCCGGCCGAGGCGGGCGACTTCAGCTTCCGCAACTACCTGGCCTACGCCGTCTACGCGCCGCT
GTACTTGGCCGGGCCGATCCTGACGTTCAACGACTACGCGTGGCAGCTGCGGCACCGGGCGGCCAGCATCGAGCG
CGGGCGCACGGCCCGCTACGCCGTCCGCTTCCTGCTCGTGCTGCTGGCCATGGAGCTGGTGCTGCACTTCGACTA
CGTCGGCGCCATCGGCAAGGCCAGCCCGGCCTGGGGCGAGTACACGGCGGCGCAGCTGAGCCTGCTGTCCTACTT
CAACCTGCACATCATCTGGCTGAAGCTGCTGCTGCCGTGGCGCCTGTTCCGGCTGTGGGCGCTGGCGGACGGCGT
CGACCCGCCCGAGAACATGGTGCGCTGCGTCAGCGACAACTACAGCACCCAGCTCTTCTGGCGCGCCTGGCACCG
CTCCTACAACCGCTGGCTGATCCGCTACCTGTACGTGCCGCTGGGCGGCGCCTCGCTGCGCAGCTGGCGCGCCGC
CGCCCGCTCCGTGCTGACCTACCTGCTCGTCTTCACCTTCGTCGCCCTCTGGCACGACATCCAGCTGCGCCTGCT
CGTCTGGGGCTGGCTCGTCGTCCTCTTCATGCTGCCGGAGTGGGCGGCCGCCTGGCTGTTCCCGCCGCGCCGCTG
GGAGGGCCGCCCGACGGCGTACCGCATGCTGTGCTGCGTCGGCGCCGTCGCCAACGTGCTGATGATGATGGCCGC
CAACCTCGTCGGCTTCGCCGTCGGCCTCGACGGCCTCGAGAGCATCGTCAAGGGCATCCTGCGGGACTGGTCAGG
TGAGCCCGATTCAATCCTTTTTTTTCCCCCTTTTTTTTTTGTTAGTCGTTGTCCTTCTTCCGTCTCCCTGTGCGT
GCGCGCCGCGAAGAGGTCGGCTGCTAATCGAGGCGGCAGGGCTCTTGTTCCTCGTCGTCGCCTGCTCGTGCCTGT
TCGTCGGCATCCAGGTCATGTTCGAGATTCGCGAGTCGGAGAAGAGGAAGGGCGTGACGCTGAGGTGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail