Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3940
Gene name
LocationContig_2064:211..1087
Strand+
Gene length (bp)876
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00319 SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain) 4.8E-09 1 29

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AFP3|MCM1_CANAL Transcription factor of morphogenesis MCM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCM1 PE=1 SV=1 1 76 9.0E-31
sp|P11746|MCM1_YEAST Pheromone receptor transcription factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM1 PE=1 SV=2 1 54 4.0E-25
sp|Q54RY6|SRFB_DICDI Serum response factor homolog B OS=Dictyostelium discoideum GN=srfB PE=3 SV=1 1 62 3.0E-22
sp|Q54TY7|SRFA_DICDI Serum response factor homolog A OS=Dictyostelium discoideum GN=srfA PE=1 SV=1 1 55 6.0E-22
sp|Q90718|SRF_CHICK Serum response factor (Fragment) OS=Gallus gallus GN=SRF PE=2 SV=1 1 105 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AFP3|MCM1_CANAL Transcription factor of morphogenesis MCM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCM1 PE=1 SV=1 1 76 9.0E-31
sp|P11746|MCM1_YEAST Pheromone receptor transcription factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM1 PE=1 SV=2 1 54 4.0E-25
sp|Q54RY6|SRFB_DICDI Serum response factor homolog B OS=Dictyostelium discoideum GN=srfB PE=3 SV=1 1 62 3.0E-22
sp|Q54TY7|SRFA_DICDI Serum response factor homolog A OS=Dictyostelium discoideum GN=srfA PE=1 SV=1 1 55 6.0E-22
sp|Q90718|SRF_CHICK Serum response factor (Fragment) OS=Gallus gallus GN=SRF PE=2 SV=1 1 105 1.0E-20
sp|P23790|SRF_XENLA Serum response factor OS=Xenopus laevis GN=srf PE=2 SV=1 1 105 1.0E-20
sp|P11831|SRF_HUMAN Serum response factor OS=Homo sapiens GN=SRF PE=1 SV=1 1 105 2.0E-20
sp|Q24535|SRF_DROME Serum response factor homolog OS=Drosophila melanogaster GN=bs PE=1 SV=2 1 56 2.0E-20
sp|P07249|ARGR1_YEAST Arginine metabolism regulation protein I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG80 PE=1 SV=2 1 55 3.0E-20
sp|Q9JM73|SRF_MOUSE Serum response factor OS=Mus musculus GN=Srf PE=1 SV=1 1 105 8.0E-20
sp|P78926|PMAP1_SCHPO Pheromone receptor transcription activator OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=map1 PE=3 SV=1 1 53 8.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0046983 protein dimerization activity Yes
GO:1901363 heterocyclic compound binding No
GO:0005515 protein binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
MADS-box

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3940
MKKAYELSVLTGTQVLLLVVSETGLVYTFTTPKLQPLVTKAEGKNLIQACLNAPEPAPGNENGVDSGDQVESPEE
SAGQHIPPQASRPGMPQNPHMPGNYMPNMPMDPQHALAYQNYVQQRSQGYGSGMPPQAGMPPSNHHQP*
Coding >Hirsu2|3940
ATGAAGAAGGCCTACGAGCTCTCCGTCTTAACCGGCACCCAAGTCCTCCTCCTCGTCGTCTCCGAAACGGGTCTC
GTCTACACCTTCACCACGCCCAAGCTCCAACCGCTCGTCACTAAGGCTGAGGGCAAGAACTTGATTCAGGCGTGT
CTGAACGCGCCGGAACCCGCGCCCGGCAACGAAAACGGCGTCGACAGCGGCGACCAGGTCGAGTCCCCCGAAGAG
TCGGCCGGCCAGCACATACCCCCCCAGGCCAGCCGCCCGGGGATGCCTCAAAATCCGCACATGCCCGGCAACTAC
ATGCCCAACATGCCGATGGACCCCCAACACGCGCTCGCCTACCAGAACTACGTGCAGCAGCGCAGTCAAGGATAC
GGCTCGGGCATGCCGCCCCAGGCGGGCATGCCGCCGAGTAACCATCACCAGCCATGA
Transcript >Hirsu2|3940
ATGAAGAAGGCCTACGAGCTCTCCGTCTTAACCGGCACCCAAGTCCTCCTCCTCGTCGTCTCCGAAACGGGTCTC
GTCTACACCTTCACCACGCCCAAGCTCCAACCGCTCGTCACTAAGGCTGAGGGCAAGAACTTGATTCAGGCGTGT
CTGAACGCGCCGGAACCCGCGCCCGGCAACGAAAACGGCGTCGACAGCGGCGACCAGGTCGAGTCCCCCGAAGAG
TCGGCCGGCCAGCACATACCCCCCCAGGCCAGCCGCCCGGGGATGCCTCAAAATCCGCACATGCCCGGCAACTAC
ATGCCCAACATGCCGATGGACCCCCAACACGCGCTCGCCTACCAGAACTACGTGCAGCAGCGCAGTCAAGGATAC
GGCTCGGGCATGCCGCCCCAGGCGGGCATGCCGCCGAGTAACCATCACCAGCCATGA
Gene >Hirsu2|3940
ATGAAGAAGGTTCGTCCATGCCTCCGACGCGCCCCCTCCCTCGGCACACGCTCTGCTCGTCTGTCCTCGCCGCGC
CTGGCGCGACCACGGCTGCGGCAAACGGCTGCGACCCCAGCGGCACCGCCCGTCCGGCCCGCGTCCCTCTCCGCT
CCGCCGTCGCCCGCCGCCCGTACTGACTCGCCCTCTTCCTCCGCCAGGCCTACGAGCTCTCCGTCTTAACCGGCA
CCCAAGTCCTCCTCCTCGTCGTCTCCGAAACGGGTCTCGTCTACACCTTCACCACGCCCAAGCTCCAACCGCTCG
TCACTAAGGCTGAGGGCAAGAACTTGATTCAGGTACGCGACCCGTGCTCGCGCGTCGGCCTCATGCCACCTGGCT
CCGACGCCCGCGCCCCCCTTCCGCCCTCCCCTTTGAACGAACGCGTATCACGAAAACCCATGCTACCCCCGCCCC
CTTTGATCCTCTTGTCCCTCGTCCCGCCTTCTCCCACCGCCCTGTCTAGGAACCATACCGTCCTGTGGCTTCGGC
TTGCTCCCCCAGCTCGCTCGCCCTGTATCAGTTCTGAACGCTGACATGTCCCGCTCGCCACAGGCGTGTCTGAAC
GCGCCGGAACCCGCGCCCGGCAACGAAAACGGCGTCGACAGCGGCGACCAGGTCGAGTCCCCCGAAGAGTCGGCC
GGCCAGCACATACCCCCCCAGGCCAGCCGCCCGGGGATGCCTCAAAATCCGCACATGCCCGGCAACTACATGCCC
AACATGCCGATGGACCCCCAACACGCGCTCGCCTACCAGAACTACGTGCAGCAGCGCAGTCAAGGATACGGCTCG
GGCATGCCGCCCCAGGCGGGCATGCCGCCGAGTAACCATCACCAGCCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail