Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|394
Gene name
LocationContig_1077:863..2828
Strand-
Gene length (bp)1965
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 3.4E-64 198 475
PF08241 Methyltransf_11 Methyltransferase domain 3.6E-12 265 365
PF13489 Methyltransf_23 Methyltransferase domain 4.0E-11 246 375
PF13649 Methyltransf_25 Methyltransferase domain 6.9E-11 265 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 13 523 0.0E+00
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 34 501 0.0E+00
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 12 496 0.0E+00
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 16 500 0.0E+00
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 195 479 5.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 13 523 0.0E+00
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 34 501 0.0E+00
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 12 496 0.0E+00
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 16 500 0.0E+00
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 195 479 5.0E-39
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 145 486 1.0E-38
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 207 487 4.0E-35
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 207 487 4.0E-35
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 204 479 9.0E-31
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 204 479 9.0E-31
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 204 479 9.0E-31
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 187 457 7.0E-27
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 187 457 7.0E-27
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 197 480 7.0E-27
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 187 457 2.0E-26
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 204 479 3.0E-26
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 204 479 3.0E-26
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 204 479 3.0E-26
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 204 479 3.0E-26
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 204 479 3.0E-26
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 204 479 1.0E-24
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 204 479 2.0E-24
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 204 479 2.0E-24
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 204 479 2.0E-24
sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA2 PE=1 SV=1 204 479 4.0E-24
sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 204 479 4.0E-24
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 204 479 9.0E-24
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 206 475 1.0E-23
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 206 475 1.0E-23
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 206 475 4.0E-23
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 206 479 3.0E-22
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 206 479 3.0E-22
sp|B2I023|UBIG_ACIBC Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=ubiG PE=3 SV=1 241 342 1.0E-10
sp|B0V5X4|UBIG_ACIBY Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AYE) GN=ubiG PE=3 SV=1 241 342 1.0E-10
sp|B7IBN2|UBIG_ACIB5 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=ubiG PE=3 SV=1 241 342 1.0E-10
sp|B7H2Y9|UBIG_ACIB3 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=ubiG PE=3 SV=1 241 342 1.0E-10
sp|B0VMN8|UBIG_ACIBS Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain SDF) GN=ubiG PE=3 SV=1 241 342 1.0E-10
sp|Q4ZQ90|UBIG_PSEU2 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiG PE=3 SV=1 236 377 1.0E-10
sp|Q48FM4|UBIG_PSE14 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiG PE=3 SV=1 236 377 1.0E-10
sp|Q6FFY1|UBIG_ACIAD Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ubiG PE=3 SV=1 241 342 3.0E-10
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 240 446 6.0E-10
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 222 441 2.0E-09
sp|A4SM99|UBIG_AERS4 Ubiquinone biosynthesis O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=ubiG PE=3 SV=1 234 425 6.0E-09
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 216 449 3.0E-08
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 252 366 7.0E-08
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 252 366 7.0E-08
sp|Q47GP8|UBIG_DECAR Ubiquinone biosynthesis O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ubiG PE=3 SV=1 260 377 8.0E-08
sp|Q88M10|UBIG_PSEPK Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=ubiG PE=3 SV=1 254 377 1.0E-07
sp|A5W7G3|UBIG_PSEP1 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiG PE=3 SV=1 254 377 1.0E-07
sp|C3K6J1|UBIG_PSEFS Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=ubiG PE=3 SV=1 236 377 1.0E-07
sp|A6V2Q4|UBIG_PSEA7 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=ubiG PE=3 SV=1 236 391 1.0E-07
sp|A1U3K1|UBIG_MARHV Ubiquinone biosynthesis O-methyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ubiG PE=3 SV=1 241 377 1.0E-07
sp|B0KTX4|UBIG_PSEPG Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain GB-1) GN=ubiG PE=3 SV=1 260 377 2.0E-07
sp|A1S6C9|UBIG_SHEAM Ubiquinone biosynthesis O-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiG PE=3 SV=1 241 342 5.0E-07
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 206 432 5.0E-07
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 240 392 8.0E-07
sp|Q2L2T5|UBIG_BORA1 Ubiquinone biosynthesis O-methyltransferase OS=Bordetella avium (strain 197N) GN=ubiG PE=3 SV=1 234 342 1.0E-06
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 259 354 2.0E-06
sp|A7MPA9|UBIG_CROS8 Ubiquinone biosynthesis O-methyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiG PE=3 SV=1 234 342 2.0E-06
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 204 373 3.0E-06
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 240 443 4.0E-06
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 204 364 4.0E-06
sp|Q87ND5|UBIG_VIBPA Ubiquinone biosynthesis O-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiG PE=3 SV=1 234 342 5.0E-06
sp|A7MU79|UBIG_VIBCB Ubiquinone biosynthesis O-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiG PE=3 SV=1 234 342 5.0E-06
sp|B5YX17|UBIG_ECO5E Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiG PE=3 SV=1 234 342 6.0E-06
sp|Q8XE29|UBIG_ECO57 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O157:H7 GN=ubiG PE=3 SV=1 234 342 6.0E-06
sp|Q8FFP0|UBIG_ECOL6 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiG PE=3 SV=1 234 342 8.0E-06
sp|B7UFP4|UBIG_ECO27 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiG PE=3 SV=1 234 342 8.0E-06
sp|B7MXR3|UBIG_ECO81 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O81 (strain ED1a) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|Q3YZX6|UBIG_SHISS Ubiquinone biosynthesis O-methyltransferase OS=Shigella sonnei (strain Ss046) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|Q820C5|UBIG_SHIFL Ubiquinone biosynthesis O-methyltransferase OS=Shigella flexneri GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|Q0T2P9|UBIG_SHIF8 Ubiquinone biosynthesis O-methyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|Q0TFL0|UBIG_ECOL5 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|Q1R9I4|UBIG_ECOUT Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|B7MFZ8|UBIG_ECO45 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|Q31Z65|UBIG_SHIBS Ubiquinone biosynthesis O-methyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|B2TW20|UBIG_SHIB3 Ubiquinone biosynthesis O-methyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|B6I7I7|UBIG_ECOSE Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain SE11) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|B7M5R7|UBIG_ECO8A Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O8 (strain IAI1) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|B7LAP9|UBIG_ECO55 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|Q32DV8|UBIG_SHIDS Ubiquinone biosynthesis O-methyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|B1LLI3|UBIG_ECOSM Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|B7N5J4|UBIG_ECOLU Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|P17993|UBIG_ECOLI Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12) GN=ubiG PE=1 SV=1 234 342 9.0E-06
sp|B1X8C6|UBIG_ECODH Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|C4ZU73|UBIG_ECOBW Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|A7ZP50|UBIG_ECO24 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiG PE=3 SV=1 234 342 9.0E-06
sp|B1IXV6|UBIG_ECOLC Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiG PE=3 SV=1 234 342 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 85 107 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|394
MSKPTSLNGSESEFEFIETPKASPPSFDKVEECGIRTTKYPSIKNGPLPADGPGSDSFNNTALLSILAGVPLYMT
WKVGGGLKTLIFFALLVDLPLLAAWWLIVSAISPRRNEKAKLPGRPVEYYLNFKKEADRAKYRGSNKIPMETFHE
MYFDGDVDFKGDCLEVMEYRHDWASFRFTVSLIKYFLTGMIPELIMHTRSQDEEQVRDHYDRGDDFYGWFLGPRM
IYTSGVISDIEKEESLEQLQDNKLAIVCEKIGLKAGEKMLDIGCGWGTLARFASENYGAHVTGITLGRNQTAWGN
SAMRKVGVTEEQSKILCMDYRDIPVPEGGYDKITCLEMAEHVGVRHFSSFLTQVYNMLDDDGVFFLQIAGLRKPW
QYEDLIWGLFMNKYIFPGADASTPLGWVVDRLEGSGFEIKGIDTIGVHYSATLWRWYRNWMANRDKVEAKYGKRW
FRIWEYFLAYSTIASRQGTATCFQITLVKNINSTHRVEGIDSAFGLSGALANCKADLQAWAAKNKVTSSTEFLS*
Coding >Hirsu2|394
ATGTCGAAGCCAACCAGCCTCAACGGCAGCGAGAGCGAATTTGAGTTCATTGAGACTCCCAAGGCCTCGCCGCCG
TCCTTCGACAAGGTAGAAGAGTGTGGGATTCGCACGACAAAGTATCCCTCCATCAAGAATGGCCCCCTCCCGGCC
GATGGCCCCGGGTCCGACTCGTTCAACAACACGGCCCTCCTCTCCATCCTCGCCGGCGTTCCGCTCTACATGACG
TGGAAGGTCGGTGGCGGCCTCAAGACGCTCATCTTCTTCGCCCTCCTAGTCGACCTCCCGCTTCTGGCAGCATGG
TGGCTCATCGTGTCCGCCATCAGCCCTCGCCGCAATGAAAAGGCCAAGCTGCCGGGCCGCCCGGTCGAGTACTAC
CTGAACTTCAAGAAGGAGGCGGACCGCGCCAAGTACCGTGGCTCCAACAAGATCCCGATGGAGACCTTCCACGAG
ATGTACTTCGACGGCGACGTCGACTTCAAGGGCGATTGCCTCGAGGTCATGGAGTATCGCCACGACTGGGCCAGC
TTCCGCTTCACCGTCAGCCTCATCAAATACTTCCTCACCGGCATGATCCCCGAGCTCATCATGCACACCCGCTCC
CAAGATGAGGAGCAGGTGCGAGACCACTACGACCGCGGCGACGACTTCTACGGCTGGTTCCTCGGCCCTCGCATG
ATCTACACGTCGGGCGTCATCTCGGACATTGAAAAGGAAGAATCGCTGGAGCAGTTGCAGGACAACAAGCTGGCC
ATTGTCTGCGAGAAGATCGGCCTCAAGGCCGGCGAGAAGATGCTCGACATTGGCTGCGGCTGGGGCACGCTCGCT
CGCTTCGCCAGCGAAAACTACGGCGCCCACGTCACCGGCATCACCCTCGGCCGCAACCAGACGGCCTGGGGCAAC
AGCGCGATGCGCAAGGTGGGCGTGACGGAGGAGCAGAGCAAGATCCTGTGCATGGACTACCGCGACATCCCCGTG
CCCGAGGGCGGCTACGACAAGATCACCTGCCTCGAGATGGCCGAGCACGTCGGCGTCCGCCACTTCTCCTCCTTC
CTGACGCAGGTGTACAACATGCTCGACGACGACGGCGTCTTCTTCCTGCAGATTGCCGGCCTCCGCAAGCCCTGG
CAGTACGAGGATCTCATCTGGGGTCTGTTCATGAACAAGTACATCTTCCCCGGCGCCGACGCCTCGACGCCCCTC
GGCTGGGTTGTCGACCGGCTCGAGGGCTCCGGCTTCGAGATCAAGGGCATCGACACCATCGGCGTCCACTACTCG
GCCACGCTCTGGCGCTGGTACCGCAACTGGATGGCCAACCGCGACAAGGTCGAGGCCAAGTACGGCAAGCGCTGG
TTCCGCATCTGGGAATACTTCCTCGCCTACTCGACCATCGCCTCCCGCCAGGGCACCGCCACCTGCTTCCAGATC
ACGCTGGTCAAGAACATCAACTCGACGCACCGGGTCGAGGGCATCGACTCGGCCTTTGGTCTGTCGGGCGCTCTC
GCCAACTGCAAGGCCGACCTGCAGGCCTGGGCCGCCAAGAACAAGGTGACGTCCTCGACCGAGTTCTTGTCTTGA
Transcript >Hirsu2|394
ATGTCGAAGCCAACCAGCCTCAACGGCAGCGAGAGCGAATTTGAGTTCATTGAGACTCCCAAGGCCTCGCCGCCG
TCCTTCGACAAGGTAGAAGAGTGTGGGATTCGCACGACAAAGTATCCCTCCATCAAGAATGGCCCCCTCCCGGCC
GATGGCCCCGGGTCCGACTCGTTCAACAACACGGCCCTCCTCTCCATCCTCGCCGGCGTTCCGCTCTACATGACG
TGGAAGGTCGGTGGCGGCCTCAAGACGCTCATCTTCTTCGCCCTCCTAGTCGACCTCCCGCTTCTGGCAGCATGG
TGGCTCATCGTGTCCGCCATCAGCCCTCGCCGCAATGAAAAGGCCAAGCTGCCGGGCCGCCCGGTCGAGTACTAC
CTGAACTTCAAGAAGGAGGCGGACCGCGCCAAGTACCGTGGCTCCAACAAGATCCCGATGGAGACCTTCCACGAG
ATGTACTTCGACGGCGACGTCGACTTCAAGGGCGATTGCCTCGAGGTCATGGAGTATCGCCACGACTGGGCCAGC
TTCCGCTTCACCGTCAGCCTCATCAAATACTTCCTCACCGGCATGATCCCCGAGCTCATCATGCACACCCGCTCC
CAAGATGAGGAGCAGGTGCGAGACCACTACGACCGCGGCGACGACTTCTACGGCTGGTTCCTCGGCCCTCGCATG
ATCTACACGTCGGGCGTCATCTCGGACATTGAAAAGGAAGAATCGCTGGAGCAGTTGCAGGACAACAAGCTGGCC
ATTGTCTGCGAGAAGATCGGCCTCAAGGCCGGCGAGAAGATGCTCGACATTGGCTGCGGCTGGGGCACGCTCGCT
CGCTTCGCCAGCGAAAACTACGGCGCCCACGTCACCGGCATCACCCTCGGCCGCAACCAGACGGCCTGGGGCAAC
AGCGCGATGCGCAAGGTGGGCGTGACGGAGGAGCAGAGCAAGATCCTGTGCATGGACTACCGCGACATCCCCGTG
CCCGAGGGCGGCTACGACAAGATCACCTGCCTCGAGATGGCCGAGCACGTCGGCGTCCGCCACTTCTCCTCCTTC
CTGACGCAGGTGTACAACATGCTCGACGACGACGGCGTCTTCTTCCTGCAGATTGCCGGCCTCCGCAAGCCCTGG
CAGTACGAGGATCTCATCTGGGGTCTGTTCATGAACAAGTACATCTTCCCCGGCGCCGACGCCTCGACGCCCCTC
GGCTGGGTTGTCGACCGGCTCGAGGGCTCCGGCTTCGAGATCAAGGGCATCGACACCATCGGCGTCCACTACTCG
GCCACGCTCTGGCGCTGGTACCGCAACTGGATGGCCAACCGCGACAAGGTCGAGGCCAAGTACGGCAAGCGCTGG
TTCCGCATCTGGGAATACTTCCTCGCCTACTCGACCATCGCCTCCCGCCAGGGCACCGCCACCTGCTTCCAGATC
ACGCTGGTCAAGAACATCAACTCGACGCACCGGGTCGAGGGCATCGACTCGGCCTTTGGTCTGTCGGGCGCTCTC
GCCAACTGCAAGGCCGACCTGCAGGCCTGGGCCGCCAAGAACAAGGTGACGTCCTCGACCGAGTTCTTGTCTTGA
Gene >Hirsu2|394
ATGTCGAAGCCAACCAGCCTCAACGGCAGCGAGAGCGAATTTGAGTTCATTGAGACTCCCAAGGCCTCGCCGCCG
TCCTTCGACAAGGTAGAAGAGTGTGGGATTCGCACGACAAAGGTACGTGACGCGGCTTGACCCTGCTCTCTGCTC
CTCCTCCCTCGACGCGCCCTCGCCGGCCTCGGGATATCGACAGCTCCGCCAGCAGGACGTGTTTCCCGGCTTCGG
CCGAGGAGCCCCTGAGGCGGCTCTGTGCACCTGCTTCGTGGCCATCGCCGTCGCTGACCGGTTTCCCCTTGGCCA
GTATCCCTCCATCAAGAATGGCCCCCTCCCGGCCGATGGCCCCGGGTCCGACTCGTTCAACAACACGGCCCTCCT
CTCCATCCTCGCCGGCGTTCCGCTCTACATGACGTGGAAGGTCGGTGGCGGCCTCAAGACGCTCATCTTCTTCGC
CCTCCTAGTCGACCTCCCGCTTCTGGCAGCATGGTGGCTCATCGTGTCCGCCATCAGCCCTCGCCGCAATGAAAA
GGCCAAGCTGCCGGGCCGCCCGGTCGAGTACTACCTGAACTTCAAGAAGGAGGCGGACCGCGCCAAGTACCGTGG
CTCCAACAAGATCCCGATGGAGACCTTCCACGAGATGTACTTCGACGGCGACGTCGACTTCAAGGGCGATTGCCT
CGAGGTCATGGAGTATCGCCACGACTGGGCCAGCTTCCGCTTCACCGTCAGCCTCATCAAATACTTCCTCACCGG
CATGATCCCCGAGCTCATCATGCACACCCGCTCCCAAGGTATGCACCGTCCTGACCGCCTCCTCGCTCCACCGGC
CGCGCCACTCTGCCCTCTCTCTCCTGCGCCGCGCGGGAGAGGCGGAAGAGGGCCCGTCTTTCGTGTCGAACCATG
CCTGACGTGGGACAACCCATAGATGAGGAGCAGGTGCGAGACCACTACGACCGCGGCGACGACTTCTACGGCTGG
TTCCTCGGCCCTCGCATGATCTACACGTCGGGCGTCATCTCGGACATTGAAAAGGAAGAATCGCTGGAGCAGTTG
CAGGACAACAAGCTGGCCATTGTCTGCGAGAAGATCGGCCTCAAGGCCGGCGAGAAGATGCTCGACATTGGCTGC
GGCTGGGGCACGCTCGCTCGCTTCGCCAGCGAAAACTACGGCGCCCACGTCACCGGCATCACCCTCGGCCGCAAC
CAGACGGCCTGGGGCAACAGCGCGATGCGCAAGGTGGGCGTGACGGAGGAGCAGAGCAAGATCCTGTGCATGGAC
TACCGCGACATCCCCGTGCCCGAGGGCGGCTACGACAAGATCACCTGCCTCGAGATGGCCGAGCACGTCGGCGTC
CGCCACTTCTCCTCCTTCCTGACGCAGGTGTACAACATGCTCGACGACGACGGCGTCTTCTTCCTGCAGATTGCC
GGCCTCCGCAAGCCCTGGCAGTACGAGGATCTCATCTGGGGTCTGTTCATGAACAAGTACATCTTCCCCGGCGCC
GACGCCTCGACGCCCCTCGGCTGGGTTGTCGACCGGCTCGAGGGCTCCGGCTTCGAGATCAAGGGCATCGACACC
ATCGGCGTCCACTACTCGGCCACGCTCTGGCGCTGGTACCGCAACTGGATGGCCAACCGCGACAAGGTCGAGGCC
AAGTACGGCAAGCGCTGGTTCCGCGTAAGTTGGCGTCTCCGCGCCGGGAGCAACTGTCGTGCACTGTTCGTTGGC
TGACGGCCCCGCCTCTGGCAGATCTGGGAATACTTCCTCGCCTACTCGACCATCGCCTCCCGCCAGGGCACCGCC
ACCTGCTTCCAGATCACGCTGGTCAAGAACATCAACTCGACGCACCGGGTCGAGGGCATCGACTCGGCCTTTGGT
CTGTCGGGCGCTCTCGCCAACTGCAAGGCCGACCTGCAGGCCTGGGCCGCCAAGAACAAGGTGACGTCCTCGACC
GAGTTCTTGTCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail