Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3936
Gene name
LocationContig_2061:1817..2753
Strand+
Gene length (bp)936
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10000 ACT_3 ACT domain 4.2E-20 144 213
PF13551 HTH_29 Winged helix-turn helix 1.2E-09 28 79
PF13518 HTH_28 Helix-turn-helix domain 7.8E-07 28 77
PF13384 HTH_23 Homeodomain-like domain 1.6E-06 26 66
PF13840 ACT_7 ACT domain 2.6E-06 213 268

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Homeodomain-like HTH
Helix-turn-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3936
MASTNLDAFGAIITSERKPKGEITPEARAAIIAAVQAGERKSVIAARFRISPAAVDRTLQRFEKTGQLVSRPRSG
RPKTKPVAEPPSEPSARVVGPVRNVRSPPGPAMASAAGNVNSNRKQQQNQHQQNQHQQNQHQLLLAADPGERSLA
TLLATLTTTLHPTTYVFTSLSPVSPLPPLAEIQLLFREPEGVTIVVSIDFATAQKMQYFFPCRMITLGVTSSLEA
VGFMAVLAARLAARNMGVNPVSGFYHDHLFVPLGREDEAVEVLAAVAREHRDKLPPPAPPSASASTSASASVSSC
AAAPSGQLPPH*
Coding >Hirsu2|3936
ATGGCATCGACAAACCTGGACGCGTTCGGGGCCATCATCACGAGCGAGCGCAAGCCCAAGGGCGAGATCACGCCC
GAGGCCCGGGCCGCCATCATCGCGGCAGTACAGGCGGGGGAGCGCAAGAGCGTCATCGCCGCCCGCTTCCGCATC
TCGCCCGCCGCCGTCGACCGGACGCTGCAGCGGTTCGAGAAGACGGGCCAGCTGGTCTCGCGCCCGCGCTCCGGC
CGGCCCAAGACCAAGCCGGTCGCCGAGCCGCCGTCGGAGCCGTCGGCGCGCGTCGTCGGGCCCGTGCGCAACGTC
CGCTCGCCGCCCGGGCCCGCCATGGCGTCCGCCGCCGGGAACGTCAACAGCAACAGGAAGCAGCAGCAGAACCAG
CACCAGCAGAACCAGCACCAGCAGAACCAGCACCAGCTCCTGCTGGCCGCCGACCCGGGCGAGCGCTCGCTGGCG
ACGCTGCTGGCGACGCTGACGACGACGCTGCACCCCACCACCTACGTCTTCACCAGCCTCAGCCCCGTCTCGCCG
CTGCCGCCGCTGGCCGAGATCCAGCTGCTGTTCCGCGAGCCCGAGGGCGTGACCATCGTCGTCAGCATCGACTTC
GCCACCGCCCAGAAGATGCAGTACTTCTTCCCCTGCCGCATGATCACCCTCGGCGTCACCTCCAGCCTCGAGGCC
GTCGGCTTCATGGCCGTCCTCGCCGCCCGCCTCGCCGCCCGCAACATGGGCGTCAACCCCGTCAGCGGCTTCTAC
CACGACCACCTGTTCGTGCCCCTCGGCCGCGAGGACGAGGCCGTCGAAGTCCTCGCCGCCGTCGCCCGCGAGCAC
CGCGACAAGCTGCCGCCACCCGCCCCGCCCTCCGCCTCCGCCTCCACCTCCGCCTCCGCCTCCGTCTCCTCCTGC
GCCGCCGCGCCCTCCGGCCAGCTGCCCCCCCACTGA
Transcript >Hirsu2|3936
ATGGCATCGACAAACCTGGACGCGTTCGGGGCCATCATCACGAGCGAGCGCAAGCCCAAGGGCGAGATCACGCCC
GAGGCCCGGGCCGCCATCATCGCGGCAGTACAGGCGGGGGAGCGCAAGAGCGTCATCGCCGCCCGCTTCCGCATC
TCGCCCGCCGCCGTCGACCGGACGCTGCAGCGGTTCGAGAAGACGGGCCAGCTGGTCTCGCGCCCGCGCTCCGGC
CGGCCCAAGACCAAGCCGGTCGCCGAGCCGCCGTCGGAGCCGTCGGCGCGCGTCGTCGGGCCCGTGCGCAACGTC
CGCTCGCCGCCCGGGCCCGCCATGGCGTCCGCCGCCGGGAACGTCAACAGCAACAGGAAGCAGCAGCAGAACCAG
CACCAGCAGAACCAGCACCAGCAGAACCAGCACCAGCTCCTGCTGGCCGCCGACCCGGGCGAGCGCTCGCTGGCG
ACGCTGCTGGCGACGCTGACGACGACGCTGCACCCCACCACCTACGTCTTCACCAGCCTCAGCCCCGTCTCGCCG
CTGCCGCCGCTGGCCGAGATCCAGCTGCTGTTCCGCGAGCCCGAGGGCGTGACCATCGTCGTCAGCATCGACTTC
GCCACCGCCCAGAAGATGCAGTACTTCTTCCCCTGCCGCATGATCACCCTCGGCGTCACCTCCAGCCTCGAGGCC
GTCGGCTTCATGGCCGTCCTCGCCGCCCGCCTCGCCGCCCGCAACATGGGCGTCAACCCCGTCAGCGGCTTCTAC
CACGACCACCTGTTCGTGCCCCTCGGCCGCGAGGACGAGGCCGTCGAAGTCCTCGCCGCCGTCGCCCGCGAGCAC
CGCGACAAGCTGCCGCCACCCGCCCCGCCCTCCGCCTCCGCCTCCACCTCCGCCTCCGCCTCCGTCTCCTCCTGC
GCCGCCGCGCCCTCCGGCCAGCTGCCCCCCCACTGA
Gene >Hirsu2|3936
ATGGCATCGACAAACCTGGACGCGTTCGGGGCCATCATCACGAGCGAGCGCAAGCCCAAGGGCGAGATCACGCCC
GAGGCCCGGGCCGCCATCATCGCGGCAGTACAGGCGGGGGAGCGCAAGAGCGTCATCGCCGCCCGCTTCCGCATC
TCGCCCGCCGCCGTCGACCGGACGCTGCAGCGGTTCGAGAAGACGGGCCAGCTGGTCTCGCGCCCGCGCTCCGGC
CGGCCCAAGACCAAGCCGGTCGCCGAGCCGCCGTCGGAGCCGTCGGCGCGCGTCGTCGGGCCCGTGCGCAACGTC
CGCTCGCCGCCCGGGCCCGCCATGGCGTCCGCCGCCGGGAACGTCAACAGCAACAGGAAGCAGCAGCAGAACCAG
CACCAGCAGAACCAGCACCAGCAGAACCAGCACCAGCTCCTGCTGGCCGCCGACCCGGGCGAGCGCTCGCTGGCG
ACGCTGCTGGCGACGCTGACGACGACGCTGCACCCCACCACCTACGTCTTCACCAGCCTCAGCCCCGTCTCGCCG
CTGCCGCCGCTGGCCGAGATCCAGCTGCTGTTCCGCGAGCCCGAGGGCGTGACCATCGTCGTCAGCATCGACTTC
GCCACCGCCCAGAAGATGCAGTACTTCTTCCCCTGCCGCATGATCACCCTCGGCGTCACCTCCAGCCTCGAGGCC
GTCGGCTTCATGGCCGTCCTCGCCGCCCGCCTCGCCGCCCGCAACATGGGCGTCAACCCCGTCAGCGGCTTCTAC
CACGACCACCTGTTCGTGCCCCTCGGCCGCGAGGACGAGGCCGTCGAAGTCCTCGCCGCCGTCGCCCGCGAGCAC
CGCGACAAGCTGCCGCCACCCGCCCCGCCCTCCGCCTCCGCCTCCACCTCCGCCTCCGCCTCCGTCTCCTCCTGC
GCCGCCGCGCCCTCCGGCCAGCTGCCCCCCCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail