Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3923
Gene name
LocationContig_206:5575..6339
Strand-
Gene length (bp)764
Transcript length (bp)597
Coding sequence length (bp)597
Protein length (aa) 199

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.9E-26 34 198
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.0E-14 43 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 34 186 1.0E-15
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 39 198 8.0E-15
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 35 198 5.0E-14
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 38 190 1.0E-13
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 38 190 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 34 186 1.0E-15
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 39 198 8.0E-15
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 35 198 5.0E-14
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 38 190 1.0E-13
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 38 190 2.0E-13
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 43 189 2.0E-13
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 38 190 5.0E-13
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 34 188 6.0E-13
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 34 187 6.0E-13
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 39 190 6.0E-13
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 34 186 8.0E-13
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 34 186 8.0E-13
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 34 186 8.0E-13
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 34 186 1.0E-12
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 34 186 1.0E-12
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 34 186 2.0E-12
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 34 186 2.0E-12
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 34 187 2.0E-12
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 34 186 3.0E-12
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 38 194 3.0E-12
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 34 189 4.0E-12
sp|Q1ZXC8|PXI_DICDI Probable serine/threonine-protein kinase pXi OS=Dictyostelium discoideum GN=pXi PE=2 SV=1 33 185 4.0E-12
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 34 186 7.0E-12
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 34 187 1.0E-11
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 34 186 1.0E-11
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 34 186 1.0E-11
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 34 187 1.0E-11
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 34 198 1.0E-11
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 34 198 1.0E-11
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 39 198 2.0E-11
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 34 186 2.0E-11
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 34 198 2.0E-11
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 39 198 2.0E-11
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 39 198 2.0E-11
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 34 186 2.0E-11
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 39 198 2.0E-11
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 34 186 2.0E-11
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 33 185 2.0E-11
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 62 198 3.0E-11
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 34 186 4.0E-11
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 36 198 4.0E-11
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 39 198 4.0E-11
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 39 198 4.0E-11
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 39 198 4.0E-11
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 18 198 4.0E-11
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 18 198 4.0E-11
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 34 198 4.0E-11
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 34 186 5.0E-11
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 34 186 5.0E-11
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 39 198 5.0E-11
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 34 198 5.0E-11
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 34 193 5.0E-11
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 35 186 6.0E-11
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 39 198 6.0E-11
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 37 189 7.0E-11
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 42 184 7.0E-11
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 34 198 8.0E-11
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 34 185 8.0E-11
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 38 187 9.0E-11
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 34 198 9.0E-11
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 43 185 9.0E-11
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 39 198 1.0E-10
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 34 188 1.0E-10
sp|P41279|M3K8_HUMAN Mitogen-activated protein kinase kinase kinase 8 OS=Homo sapiens GN=MAP3K8 PE=1 SV=2 34 198 1.0E-10
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 36 198 1.0E-10
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 41 189 2.0E-10
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 34 198 2.0E-10
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 34 186 2.0E-10
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 34 198 2.0E-10
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 44 185 2.0E-10
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 38 189 2.0E-10
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 34 187 3.0E-10
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 30 187 3.0E-10
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 38 189 3.0E-10
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 54 185 3.0E-10
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 35 187 3.0E-10
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 34 187 4.0E-10
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 34 198 4.0E-10
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 34 187 4.0E-10
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 34 187 4.0E-10
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 40 188 4.0E-10
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 38 197 4.0E-10
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 35 188 5.0E-10
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 34 198 5.0E-10
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 39 188 5.0E-10
sp|P9WI71|PKNH_MYCTU Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknH PE=1 SV=1 43 198 5.0E-10
sp|P9WI70|PKNH_MYCTO Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknH PE=3 SV=1 43 198 5.0E-10
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 38 189 5.0E-10
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 34 198 5.0E-10
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 34 185 6.0E-10
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 39 194 7.0E-10
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 39 188 7.0E-10
sp|Q55CL6|MP2K1_DICDI Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum GN=mekA PE=1 SV=1 39 189 7.0E-10
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 38 189 8.0E-10
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 39 189 8.0E-10
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 39 184 8.0E-10
sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 34 188 8.0E-10
sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 34 188 9.0E-10
sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 34 188 9.0E-10
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 38 197 9.0E-10
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 33 198 9.0E-10
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 37 189 1.0E-09
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 43 198 1.0E-09
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 45 193 1.0E-09
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 39 189 1.0E-09
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 43 188 1.0E-09
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 34 198 1.0E-09
sp|Q8SSA8|CHK1_ENCCU Probable serine/threonine-protein kinase CHK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHK1 PE=3 SV=1 64 187 1.0E-09
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 35 198 1.0E-09
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 34 198 1.0E-09
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 61 198 1.0E-09
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 33 198 1.0E-09
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 41 189 1.0E-09
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 34 198 2.0E-09
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 34 198 2.0E-09
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 33 198 2.0E-09
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 48 198 2.0E-09
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 39 197 2.0E-09
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 38 197 2.0E-09
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 36 198 2.0E-09
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 43 188 2.0E-09
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 37 198 2.0E-09
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 34 185 2.0E-09
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 61 198 2.0E-09
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 40 189 2.0E-09
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 40 189 2.0E-09
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 48 198 2.0E-09
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 39 197 2.0E-09
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 39 197 2.0E-09
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 38 189 2.0E-09
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 33 198 2.0E-09
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 33 198 2.0E-09
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 33 198 2.0E-09
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 33 198 2.0E-09
sp|Q07174|M3K8_MOUSE Mitogen-activated protein kinase kinase kinase 8 OS=Mus musculus GN=Map3k8 PE=1 SV=1 34 198 2.0E-09
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 33 198 2.0E-09
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 34 198 2.0E-09
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 43 188 2.0E-09
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 33 198 2.0E-09
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 33 198 2.0E-09
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 39 187 3.0E-09
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 38 189 3.0E-09
sp|Q63562|M3K8_RAT Mitogen-activated protein kinase kinase kinase 8 OS=Rattus norvegicus GN=Map3k8 PE=1 SV=1 34 198 3.0E-09
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 40 198 3.0E-09
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 37 198 3.0E-09
sp|P24786|NTRK3_PIG NT-3 growth factor receptor OS=Sus scrofa GN=NTRK3 PE=2 SV=1 42 193 3.0E-09
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 34 185 3.0E-09
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 33 198 3.0E-09
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 38 189 3.0E-09
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 62 187 3.0E-09
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 34 187 3.0E-09
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 39 198 4.0E-09
sp|O65924|Y2921_ARATH Putative leucine-rich repeat receptor-like protein kinase At2g19210 OS=Arabidopsis thaliana GN=At2g19210 PE=3 SV=1 43 198 4.0E-09
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 34 188 4.0E-09
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 65 198 4.0E-09
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 34 185 4.0E-09
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 39 197 4.0E-09
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 42 198 4.0E-09
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 34 198 4.0E-09
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 42 198 5.0E-09
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 34 198 5.0E-09
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 62 187 5.0E-09
sp|Q7U095|PKNH_MYCBO Serine/threonine-protein kinase PknH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknH PE=3 SV=1 43 198 5.0E-09
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 61 198 5.0E-09
sp|Q5IS37|NTRK3_PANTR NT-3 growth factor receptor OS=Pan troglodytes GN=NTRK3 PE=2 SV=1 42 193 5.0E-09
sp|Q91044|NTRK3_CHICK NT-3 growth factor receptor OS=Gallus gallus GN=NTRK3 PE=1 SV=2 42 193 5.0E-09
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 38 188 5.0E-09
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 39 194 5.0E-09
sp|Q5IFJ9|NTRK3_MACFA NT-3 growth factor receptor OS=Macaca fascicularis GN=NTRK3 PE=2 SV=1 42 193 5.0E-09
sp|Q6VNS1|NTRK3_MOUSE NT-3 growth factor receptor OS=Mus musculus GN=Ntrk3 PE=1 SV=1 42 193 5.0E-09
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 33 189 5.0E-09
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 35 187 5.0E-09
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 34 185 5.0E-09
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 39 189 5.0E-09
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 35 188 5.0E-09
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 33 189 5.0E-09
sp|Q91727|CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis GN=cdk4 PE=1 SV=1 34 198 6.0E-09
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 34 198 6.0E-09
sp|O64556|Y2923_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Arabidopsis thaliana GN=At2g19230 PE=3 SV=3 40 198 6.0E-09
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 44 187 6.0E-09
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 33 189 6.0E-09
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 97 187 6.0E-09
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 39 194 6.0E-09
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 33 189 6.0E-09
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 35 188 6.0E-09
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 34 187 6.0E-09
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 39 198 6.0E-09
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 34 188 6.0E-09
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 34 192 6.0E-09
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 37 198 6.0E-09
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 39 198 7.0E-09
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 34 185 7.0E-09
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 39 189 7.0E-09
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 61 198 7.0E-09
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 39 186 7.0E-09
sp|Q63572|TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus GN=Tesk1 PE=1 SV=1 39 198 7.0E-09
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 62 187 8.0E-09
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 34 187 8.0E-09
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 39 198 8.0E-09
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 34 187 8.0E-09
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 34 187 8.0E-09
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 39 198 8.0E-09
sp|Q99078|FUZ7_USTMA Dual specificity protein kinase FUZ7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FUZ7 PE=3 SV=2 39 198 8.0E-09
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 34 187 8.0E-09
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 34 187 8.0E-09
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 63 198 8.0E-09
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 39 189 9.0E-09
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 34 187 9.0E-09
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 34 187 9.0E-09
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 39 198 9.0E-09
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 42 198 9.0E-09
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 39 189 9.0E-09
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 64 198 9.0E-09
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 4 197 9.0E-09
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 39 189 9.0E-09
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 40 188 9.0E-09
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 51 198 1.0E-08
sp|Q9LK43|TMK4_ARATH Receptor-like kinase TMK4 OS=Arabidopsis thaliana GN=TMK4 PE=1 SV=1 57 198 1.0E-08
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 34 185 1.0E-08
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 39 198 1.0E-08
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 39 198 1.0E-08
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 34 185 1.0E-08
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 39 198 1.0E-08
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 121 198 1.0E-08
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 34 185 1.0E-08
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 39 186 1.0E-08
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 33 198 1.0E-08
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 39 194 1.0E-08
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk3 PE=1 SV=3 64 198 1.0E-08
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 34 198 1.0E-08
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 39 197 2.0E-08
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 33 178 2.0E-08
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 39 198 2.0E-08
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 40 198 2.0E-08
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 38 190 2.0E-08
sp|G5EDT6|JKK1_CAEEL Dual specificity mitogen-activated protein kinase kinase jkk-1 OS=Caenorhabditis elegans GN=jkk-1 PE=1 SV=1 40 184 2.0E-08
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 34 186 2.0E-08
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 39 186 2.0E-08
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 39 186 2.0E-08
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 39 198 2.0E-08
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 34 189 2.0E-08
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 39 197 2.0E-08
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 3 198 2.0E-08
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 39 189 2.0E-08
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 38 197 2.0E-08
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 62 185 2.0E-08
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 39 189 2.0E-08
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 39 186 2.0E-08
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 40 189 2.0E-08
sp|P24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEK1 PE=3 SV=1 44 195 2.0E-08
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 37 198 2.0E-08
sp|P9WI75|PKNF_MYCTU Serine/threonine-protein kinase PknF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknF PE=1 SV=1 44 186 2.0E-08
sp|P9WI74|PKNF_MYCTO Serine/threonine-protein kinase PknF OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknF PE=3 SV=1 44 186 2.0E-08
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 36 198 2.0E-08
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 38 197 2.0E-08
sp|Q7TZN1|PKNF_MYCBO Serine/threonine-protein kinase PknF OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknF PE=3 SV=1 44 186 2.0E-08
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 34 189 2.0E-08
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 34 189 2.0E-08
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 63 198 2.0E-08
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 38 186 3.0E-08
sp|Q5IS82|NTRK3_SAIBB NT-3 growth factor receptor OS=Saimiri boliviensis boliviensis GN=NTRK3 PE=2 SV=1 42 193 3.0E-08
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 38 197 3.0E-08
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 39 198 3.0E-08
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 34 198 3.0E-08
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 34 187 3.0E-08
sp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g59700 OS=Arabidopsis thaliana GN=At5g59700 PE=3 SV=1 48 198 3.0E-08
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 34 188 3.0E-08
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 39 187 3.0E-08
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 40 189 3.0E-08
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 39 198 3.0E-08
sp|Q03351|NTRK3_RAT NT-3 growth factor receptor OS=Rattus norvegicus GN=Ntrk3 PE=1 SV=2 42 165 3.0E-08
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 34 187 3.0E-08
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 34 198 3.0E-08
sp|P15209|NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus GN=Ntrk2 PE=1 SV=1 42 193 3.0E-08
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 42 189 3.0E-08
sp|Q63604|NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus GN=Ntrk2 PE=1 SV=1 42 193 3.0E-08
sp|Q16288|NTRK3_HUMAN NT-3 growth factor receptor OS=Homo sapiens GN=NTRK3 PE=1 SV=2 42 165 3.0E-08
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 40 185 3.0E-08
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 43 189 4.0E-08
sp|Q16620|NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens GN=NTRK2 PE=1 SV=1 42 193 4.0E-08
sp|Q54Y90|Y0133_DICDI Probable serine/threonine-protein kinase DDB_G0278665 OS=Dictyostelium discoideum GN=DDB_G0278665 PE=3 SV=1 61 190 4.0E-08
sp|Q91987|NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus GN=NTRK2 PE=1 SV=1 42 193 4.0E-08
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 34 188 4.0E-08
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 43 188 4.0E-08
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 43 198 4.0E-08
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 33 194 4.0E-08
sp|Q62862|MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus GN=Map2k5 PE=1 SV=1 34 195 4.0E-08
sp|Q91009|NTRK1_CHICK High affinity nerve growth factor receptor (Fragment) OS=Gallus gallus GN=NTRK1 PE=2 SV=1 41 193 4.0E-08
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 43 189 5.0E-08
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 34 189 5.0E-08
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 40 189 5.0E-08
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 34 198 5.0E-08
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 61 189 5.0E-08
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 61 189 5.0E-08
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 61 198 5.0E-08
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 33 194 5.0E-08
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 38 190 5.0E-08
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 33 184 5.0E-08
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 39 186 6.0E-08
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 34 186 6.0E-08
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 38 191 6.0E-08
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 38 191 6.0E-08
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 40 188 6.0E-08
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 39 189 6.0E-08
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 64 198 7.0E-08
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 62 198 7.0E-08
sp|Q24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster GN=Dsor1 PE=1 SV=2 64 187 7.0E-08
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 65 198 7.0E-08
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 65 189 7.0E-08
sp|Q388M1|GSK3B_TRYB2 Glycogen synthase kinase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=GSK3 PE=1 SV=1 34 198 7.0E-08
sp|P9WI79|PKND_MYCTU Serine/threonine-protein kinase PknD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknD PE=1 SV=1 34 198 8.0E-08
sp|P9WI78|PKND_MYCTO Serine/threonine-protein kinase PknD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknD PE=1 SV=1 34 198 8.0E-08
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 37 198 8.0E-08
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 39 198 8.0E-08
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 64 187 9.0E-08
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 34 188 9.0E-08
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 34 188 1.0E-07
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 34 188 1.0E-07
sp|Q9FX43|M2K9_ARATH Mitogen-activated protein kinase kinase 9 OS=Arabidopsis thaliana GN=MKK9 PE=1 SV=1 56 186 1.0E-07
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 64 186 1.0E-07
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 34 185 1.0E-07
sp|Q9FN94|RLK7_ARATH Receptor-like protein kinase At5g59670 OS=Arabidopsis thaliana GN=At5g59670 PE=1 SV=1 43 198 1.0E-07
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 33 198 1.0E-07
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 34 188 1.0E-07
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 34 198 1.0E-07
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 34 188 1.0E-07
sp|Q9WVS7|MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus GN=Map2k5 PE=1 SV=1 37 195 1.0E-07
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 44 198 1.0E-07
sp|Q39202|RLK1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 OS=Arabidopsis thaliana GN=RLK1 PE=2 SV=2 61 198 1.0E-07
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 39 185 1.0E-07
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 64 198 1.0E-07
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 34 188 1.0E-07
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 34 188 1.0E-07
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 44 198 1.0E-07
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 38 186 1.0E-07
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 44 198 1.0E-07
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 34 188 1.0E-07
sp|Q13163|MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens GN=MAP2K5 PE=1 SV=2 34 194 1.0E-07
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 34 198 1.0E-07
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 34 190 1.0E-07
sp|Q9ASQ5|CRCK3_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 3 OS=Arabidopsis thaliana GN=CRCK3 PE=2 SV=1 37 198 1.0E-07
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 61 198 1.0E-07
sp|Q5A649|ATG1_CANAL Serine/threonine-protein kinase ATG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG1 PE=3 SV=1 34 198 1.0E-07
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 34 188 1.0E-07
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 40 188 1.0E-07
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 40 195 1.0E-07
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 34 187 1.0E-07
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 65 198 2.0E-07
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 43 198 2.0E-07
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 34 188 2.0E-07
sp|P10506|BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr1 PE=1 SV=1 42 198 2.0E-07
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 34 198 2.0E-07
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 65 198 2.0E-07
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 34 188 2.0E-07
sp|Q9S7I6|RPK2_ARATH LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=2 SV=1 65 198 2.0E-07
sp|Q9V3Q6|M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster GN=Tak1 PE=2 SV=1 61 198 2.0E-07
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 40 198 2.0E-07
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 36 198 2.0E-07
sp|Q3UFB7|NTRK1_MOUSE High affinity nerve growth factor receptor OS=Mus musculus GN=Ntrk1 PE=1 SV=2 42 193 2.0E-07
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 65 198 2.0E-07
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 34 198 2.0E-07
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 34 198 2.0E-07
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 61 198 2.0E-07
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 61 198 2.0E-07
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 43 198 2.0E-07
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 65 198 2.0E-07
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 49 184 2.0E-07
sp|Q6FL58|ATG1_CANGA Serine/threonine-protein kinase ATG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG1 PE=3 SV=1 35 198 2.0E-07
sp|Q9ZQQ7|Y2144_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 OS=Arabidopsis thaliana GN=At2g14440 PE=3 SV=1 43 198 2.0E-07
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 34 187 2.0E-07
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 5 198 2.0E-07
sp|A7TIZ4|ATG1_VANPO Serine/threonine-protein kinase atg1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG1 PE=3 SV=1 39 198 2.0E-07
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 34 198 2.0E-07
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 34 187 2.0E-07
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 34 187 2.0E-07
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 34 187 2.0E-07
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 34 185 2.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 44 189 3.0E-07
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 43 189 3.0E-07
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 39 189 3.0E-07
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 63 189 3.0E-07
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 34 185 3.0E-07
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 39 198 3.0E-07
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 34 188 3.0E-07
sp|Q54LH8|Y6627_DICDI Probable serine/threonine-protein kinase DDB_G0286627 OS=Dictyostelium discoideum GN=DDB_G0286627 PE=3 SV=1 41 198 3.0E-07
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 34 188 3.0E-07
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 57 186 3.0E-07
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 20 198 3.0E-07
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 20 198 3.0E-07
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 39 198 3.0E-07
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 34 198 3.0E-07
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 34 198 3.0E-07
sp|P35739|NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus GN=Ntrk1 PE=1 SV=1 42 193 3.0E-07
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 40 185 3.0E-07
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 37 198 3.0E-07
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 62 185 3.0E-07
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 34 187 3.0E-07
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 44 188 3.0E-07
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 97 198 3.0E-07
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 44 188 3.0E-07
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 36 186 3.0E-07
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 36 186 3.0E-07
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 34 185 3.0E-07
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 38 191 3.0E-07
sp|Q9M8J5|M2K8_ARATH Mitogen-activated protein kinase kinase 8 OS=Arabidopsis thaliana GN=MKK8 PE=3 SV=2 64 184 3.0E-07
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 43 187 3.0E-07
sp|Q3ECH2|Y1670_ARATH Probable receptor-like protein kinase At1g67000 OS=Arabidopsis thaliana GN=At1g67000 PE=2 SV=2 41 198 3.0E-07
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 44 188 3.0E-07
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 38 186 3.0E-07
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 34 188 4.0E-07
sp|Q4KSH7|MP2K7_RAT Dual specificity mitogen-activated protein kinase kinase 7 OS=Rattus norvegicus GN=Map2k7 PE=1 SV=1 39 184 4.0E-07
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 34 187 4.0E-07
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 34 189 4.0E-07
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 34 185 4.0E-07
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 43 198 4.0E-07
sp|Q9WUN2|TBK1_MOUSE Serine/threonine-protein kinase TBK1 OS=Mus musculus GN=Tbk1 PE=1 SV=1 39 188 4.0E-07
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 34 189 4.0E-07
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 20 198 4.0E-07
sp|O04534|LRK51_ARATH Putative L-type lectin-domain containing receptor kinase V.1 OS=Arabidopsis thaliana GN=LECRK51 PE=3 SV=1 43 198 4.0E-07
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 34 198 4.0E-07
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 34 186 4.0E-07
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 40 189 4.0E-07
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 37 189 4.0E-07
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 34 187 4.0E-07
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 34 189 4.0E-07
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 34 185 4.0E-07
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 44 198 5.0E-07
sp|O14733|MP2K7_HUMAN Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens GN=MAP2K7 PE=1 SV=2 39 184 5.0E-07
sp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana GN=HERK1 PE=1 SV=1 51 198 5.0E-07
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 34 198 5.0E-07
sp|Q9UHD2|TBK1_HUMAN Serine/threonine-protein kinase TBK1 OS=Homo sapiens GN=TBK1 PE=1 SV=1 39 188 5.0E-07
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 34 198 5.0E-07
sp|Q9TZM3|LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans GN=lrk-1 PE=1 SV=6 56 198 5.0E-07
sp|P43298|TMK1_ARATH Receptor protein kinase TMK1 OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1 57 198 5.0E-07
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 33 198 6.0E-07
sp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR2 OS=Arabidopsis thaliana GN=ANX2 PE=2 SV=1 37 198 6.0E-07
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 40 198 6.0E-07
sp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=3 SV=1 36 198 6.0E-07
sp|P11802|CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens GN=CDK4 PE=1 SV=2 34 186 6.0E-07
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 43 198 6.0E-07
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 65 198 7.0E-07
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 34 187 7.0E-07
sp|Q8CE90|MP2K7_MOUSE Dual specificity mitogen-activated protein kinase kinase 7 OS=Mus musculus GN=Map2k7 PE=1 SV=1 39 184 7.0E-07
sp|Q9SJT0|Y2214_ARATH Probable receptor-like protein kinase At2g21480 OS=Arabidopsis thaliana GN=At2g21480 PE=3 SV=1 37 198 7.0E-07
sp|Q9U2Q9|GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans GN=gsk-3 PE=1 SV=1 64 198 7.0E-07
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 38 191 7.0E-07
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 34 189 7.0E-07
sp|Q6Z829|WEE1_ORYSJ Wee1-like protein kinase OS=Oryza sativa subsp. japonica GN=WEE1 PE=3 SV=1 55 198 7.0E-07
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 37 188 7.0E-07
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 55 198 8.0E-07
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 34 198 8.0E-07
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 33 198 8.0E-07
sp|Q15569|TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens GN=TESK1 PE=1 SV=2 39 198 8.0E-07
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 43 187 8.0E-07
sp|Q9LUC3|MPK19_ARATH Mitogen-activated protein kinase 19 OS=Arabidopsis thaliana GN=MPK19 PE=2 SV=2 33 185 8.0E-07
sp|P18431|SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster GN=sgg PE=1 SV=3 37 198 9.0E-07
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 34 186 9.0E-07
sp|Q8VYY5|NCRK_ARATH Receptor-like serine/threonine-protein kinase NCRK OS=Arabidopsis thaliana GN=NCRK PE=1 SV=1 40 184 9.0E-07
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 34 188 9.0E-07
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 34 185 9.0E-07
sp|P36507|MP2K2_HUMAN Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens GN=MAP2K2 PE=1 SV=1 64 187 9.0E-07
sp|P04629|NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens GN=NTRK1 PE=1 SV=4 42 193 9.0E-07
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 44 189 1.0E-06
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 34 186 1.0E-06
sp|Q5ZCI1|MPK10_ORYSJ Mitogen-activated protein kinase 10 OS=Oryza sativa subsp. japonica GN=MPK10 PE=2 SV=2 33 185 1.0E-06
sp|Q5VN19|MPK11_ORYSJ Mitogen-activated protein kinase 11 OS=Oryza sativa subsp. japonica GN=MPK11 PE=2 SV=2 33 185 1.0E-06
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 67 198 1.0E-06
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 34 185 1.0E-06
sp|Q924U5|TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus GN=Tesk2 PE=2 SV=1 64 198 1.0E-06
sp|C0LGQ7|Y4245_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20450 OS=Arabidopsis thaliana GN=At4g20450 PE=2 SV=1 36 198 1.0E-06
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 33 198 1.0E-06
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 39 198 1.0E-06
sp|C0LGW2|PAM74_ARATH Probable LRR receptor-like serine/threonine-protein kinase PAM74 OS=Arabidopsis thaliana GN=PAM74 PE=2 SV=1 43 198 1.0E-06
sp|Q9ZR79|LRK57_ARATH L-type lectin-domain containing receptor kinase V.7 OS=Arabidopsis thaliana GN=LECRK57 PE=2 SV=2 55 198 1.0E-06
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 39 184 1.0E-06
sp|Q9C5C0|MPK18_ARATH Mitogen-activated protein kinase 18 OS=Arabidopsis thaliana GN=MPK18 PE=1 SV=4 33 185 1.0E-06
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 39 198 1.0E-06
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 40 188 1.0E-06
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 74 185 1.0E-06
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 15 198 1.0E-06
sp|O22834|LRK53_ARATH Probable L-type lectin-domain containing receptor kinase V.3 OS=Arabidopsis thaliana GN=LECRK53 PE=3 SV=1 43 198 1.0E-06
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 38 188 1.0E-06
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 34 198 1.0E-06
sp|Q9SR05|ANX1_ARATH Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1 48 198 1.0E-06
sp|Q8VCT9|TESK2_MOUSE Dual specificity testis-specific protein kinase 2 OS=Mus musculus GN=Tesk2 PE=1 SV=1 64 198 1.0E-06
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 40 198 1.0E-06
sp|Q54R58|YTYK2_DICDI Probable tyrosine-protein kinase DDB_G0283397 OS=Dictyostelium discoideum GN=DDB_G0283397 PE=3 SV=1 40 198 2.0E-06
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 34 189 2.0E-06
sp|Q9JJX8|ST32B_MOUSE Serine/threonine-protein kinase 32B OS=Mus musculus GN=Stk32b PE=2 SV=2 38 187 2.0E-06
sp|Q552E9|PKGA_DICDI Probable serine/threonine-protein kinase pkgA OS=Dictyostelium discoideum GN=pkgA PE=3 SV=1 34 165 2.0E-06
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 34 198 2.0E-06
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 40 186 2.0E-06
sp|Q90321|MP2K2_CYPCA Dual specificity mitogen-activated protein kinase kinase 2 OS=Cyprinus carpio GN=map2k2 PE=2 SV=1 64 187 2.0E-06
sp|P36506|MP2K2_RAT Dual specificity mitogen-activated protein kinase kinase 2 OS=Rattus norvegicus GN=Map2k2 PE=1 SV=1 64 187 2.0E-06
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 43 198 2.0E-06
sp|Q9XT09|MP2K1_PANTR Dual specificity mitogen-activated protein kinase kinase 1 OS=Pan troglodytes GN=MAP2K1 PE=2 SV=3 64 187 2.0E-06
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 38 187 2.0E-06
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 124 188 2.0E-06
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 124 188 2.0E-06
sp|Q5Z9J0|MPK12_ORYSJ Mitogen-activated protein kinase 12 OS=Oryza sativa subsp. japonica GN=MPK12 PE=1 SV=2 33 185 2.0E-06
sp|Q63932|MP2K2_MOUSE Dual specificity mitogen-activated protein kinase kinase 2 OS=Mus musculus GN=Map2k2 PE=1 SV=2 64 187 2.0E-06
sp|Q54VC0|Y9865_DICDI Probable serine/threonine-protein kinase DDB_G0280461 OS=Dictyostelium discoideum GN=DDB_G0280461 PE=3 SV=1 40 185 2.0E-06
sp|Q86HG9|Y9871_DICDI Probable serine/threonine-protein kinase DDB_G0271682 OS=Dictyostelium discoideum GN=DDB_G0271682 PE=3 SV=2 66 198 2.0E-06
sp|Q1HG70|MP2K2_CANLF Dual specificity mitogen-activated protein kinase kinase 2 OS=Canis lupus familiaris GN=MAP2K2 PE=2 SV=1 64 187 2.0E-06
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 38 188 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3923
MARIKDRHTRHAVGYEENLRLARTVDENETEPSAVDVDTGNFLAVKIIKAPKGENTRQLCEMKRDVEILARMIHP
HIVEFIGFQGWGEPEAEIFMGLKQGTLGSLVRSRSFATGNLGNALLSHMLQALDFLAVQDIVHRDVKPVNILYVV
EAGQLRFQLGDFGLSNRISDAVTFAGSLFYMAPEMFQRRQRQTHKVDV*
Coding >Hirsu2|3923
ATGGCCCGCATCAAGGATCGGCACACGCGGCACGCAGTTGGCTACGAAGAGAACCTCCGCCTGGCCCGGACCGTC
GACGAGAACGAAACAGAACCATCCGCCGTCGACGTCGACACGGGAAATTTTCTGGCCGTCAAGATCATCAAGGCG
CCCAAGGGAGAAAATACGAGGCAGCTATGCGAAATGAAGCGCGACGTTGAGATCCTTGCTAGGATGATCCACCCA
CACATCGTCGAATTCATCGGCTTTCAGGGCTGGGGAGAACCGGAGGCTGAGATATTCATGGGGCTCAAGCAGGGG
ACTCTGGGATCGCTTGTTCGCAGCCGAAGCTTCGCAACTGGCAACTTGGGCAACGCCCTGCTCAGCCACATGCTC
CAAGCTCTTGACTTCCTAGCCGTGCAAGACATCGTTCACCGGGATGTGAAGCCCGTCAACATCCTATACGTCGTC
GAGGCGGGCCAGCTCCGATTCCAGCTCGGTGACTTTGGTCTCTCCAACCGCATTAGCGACGCTGTCACCTTTGCC
GGCAGCTTGTTTTACATGGCGCCCGAGATGTTCCAGCGGCGACAGAGGCAAACGCACAAGGTCGACGTCTAG
Transcript >Hirsu2|3923
ATGGCCCGCATCAAGGATCGGCACACGCGGCACGCAGTTGGCTACGAAGAGAACCTCCGCCTGGCCCGGACCGTC
GACGAGAACGAAACAGAACCATCCGCCGTCGACGTCGACACGGGAAATTTTCTGGCCGTCAAGATCATCAAGGCG
CCCAAGGGAGAAAATACGAGGCAGCTATGCGAAATGAAGCGCGACGTTGAGATCCTTGCTAGGATGATCCACCCA
CACATCGTCGAATTCATCGGCTTTCAGGGCTGGGGAGAACCGGAGGCTGAGATATTCATGGGGCTCAAGCAGGGG
ACTCTGGGATCGCTTGTTCGCAGCCGAAGCTTCGCAACTGGCAACTTGGGCAACGCCCTGCTCAGCCACATGCTC
CAAGCTCTTGACTTCCTAGCCGTGCAAGACATCGTTCACCGGGATGTGAAGCCCGTCAACATCCTATACGTCGTC
GAGGCGGGCCAGCTCCGATTCCAGCTCGGTGACTTTGGTCTCTCCAACCGCATTAGCGACGCTGTCACCTTTGCC
GGCAGCTTGTTTTACATGGCGCCCGAGATGTTCCAGCGGCGACAGAGGCAAACGCACAAGGTCGACGTCTAG
Gene >Hirsu2|3923
ATGGCCCGCATCAAGGATCGGCACACGCGGCACGCAGTTGGCTACGAAGAGAACCTCCGCCTGGCCCGGACCGTC
GACGAGAACGAAACAGAACCATCGTCACAGAGGCAGACCAGAGTTCATACGCCGGCGCATCCCAAGATCAGATAC
AAAACAAATATATGAGCTTGGAAAAGGGGAGTTCGGAGAGGTACACAGCGCCGTCGACGTCGACACGGGAAATTT
TCTGGCCGTCAAGATCATCAAGGCGCCCAAGGGAGAAAATACGAGGCAGCTATGCGAAATGAAGCGCGACGTTGA
GATCCTTGCTAGGATGATCCACGTGAGCCCCCGCCCCCCGGTTCTTTGGGACTTCATTGTTAGTGCCTTGAAGCT
GACGGAAACACCAGCCACACATCGTCGAATTCATCGGCTTTCAGGGCTGGGGAGAACCGGAGGCTGAGATATTCA
TGGGGCTCAAGCAGGGGACTCTGGGATCGCTTGTTCGCAGCCGAAGCTTCGCAACTGGCAACTTGGGCAACGCCC
TGCTCAGCCACATGCTCCAAGCTCTTGACTTCCTAGCCGTGCAAGACATCGTTCACCGGGATGTGAAGCCCGTCA
ACATCCTATACGTCGTCGAGGCGGGCCAGCTCCGATTCCAGCTCGGTGACTTTGGTCTCTCCAACCGCATTAGCG
ACGCTGTCACCTTTGCCGGCAGCTTGTTTTACATGGCGCCCGAGATGTTCCAGCGGCGACAGAGGCAAACGCACA
AGGTCGACGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail