Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3909
Gene name
LocationContig_2052:1537..3428
Strand-
Gene length (bp)1891
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.3E-30 130 405
PF07690 MFS_1 Major Facilitator Superfamily 1.9E-18 323 494
PF00083 Sugar_tr Sugar (and other) transporter 4.2E-05 125 217
PF06779 MFS_4 Uncharacterised MFS-type transporter YbfB 3.7E-06 142 492

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 43 468 1.0E-37
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 104 468 2.0E-33
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 108 501 4.0E-26
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 108 500 8.0E-25
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 108 501 4.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 43 468 1.0E-37
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 104 468 2.0E-33
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 108 501 4.0E-26
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 108 500 8.0E-25
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 108 501 4.0E-24
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 108 500 2.0E-23
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 108 419 3.0E-19
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 108 477 1.0E-15
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 108 477 1.0E-15
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 88 475 4.0E-15
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 108 495 5.0E-15
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 81 501 7.0E-15
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 108 496 8.0E-15
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 108 475 1.0E-14
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 108 495 2.0E-14
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 108 479 9.0E-14
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 81 501 5.0E-13
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 81 501 5.0E-13
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 158 435 2.0E-12
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 98 493 2.0E-12
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 93 484 4.0E-12
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 93 484 4.0E-12
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 108 494 9.0E-12
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 80 497 2.0E-10
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 93 493 2.0E-10
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 108 244 5.0E-10
sp|O95907|MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1 108 501 7.0E-10
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 108 244 1.0E-09
sp|Q8R0M8|MOT5_MOUSE Monocarboxylate transporter 5 OS=Mus musculus GN=Slc16a4 PE=2 SV=1 90 260 1.0E-09
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 108 244 2.0E-09
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 108 244 2.0E-09
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 108 244 3.0E-09
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 108 501 5.0E-09
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 108 501 5.0E-09
sp|O15374|MOT5_HUMAN Monocarboxylate transporter 5 OS=Homo sapiens GN=SLC16A4 PE=2 SV=1 90 277 3.0E-08
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 85 244 5.0E-08
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 108 503 6.0E-08
sp|Q8NCK7|MOT11_HUMAN Monocarboxylate transporter 11 OS=Homo sapiens GN=SLC16A11 PE=2 SV=1 68 507 6.0E-08
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 93 379 1.0E-07
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 46 493 1.0E-07
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 38 475 1.0E-06
sp|O31444|YBFB_BACSU Uncharacterized MFS-type transporter YbfB OS=Bacillus subtilis (strain 168) GN=ybfB PE=3 SV=1 108 497 1.0E-06
sp|G5E8K6|MOT6_MOUSE Monocarboxylate transporter 6 OS=Mus musculus GN=Slc16a5 PE=3 SV=1 100 493 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 109 131 22
2 146 168 22
3 181 203 22
4 207 229 22
5 234 256 22
6 266 285 19
7 322 344 22
8 354 376 22
9 383 405 22
10 409 431 22
11 443 465 22
12 475 497 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3909
MPPANPDRLRDVPTEPGPGPGPVLRQEAGGDQYLASTTPTLQDAIRTTEVEPKPDPDSIASSAACPKPVAEEKAW
AVDERPAFSLCSSPIKESSGANPVIASSGGLRGWLVVAGGFIDFTVAFGLLNSFGTFQARYEEKWSHLSTTTITW
IGSIQLCLFFLGGLFVGPAFDKYGSRCLMQLGTAFCLASFVCTSWSTQYWHYLLAQGLLFGVGNALLFYPATGAI
SGWFNEKRGLALGIAVSGSSLGGVFWPVIIDRLFDVMEEEVVHRIIALISTPLLVLSCFLVRERPEEPGQDGGQG
HGQGQGQSLKTSLIAALCERRFLALSVSLMILNAGMLIPFFYIPLYSQEQGIDATMANNLLAITYSGSFFSRIAA
GWLADKFGRFNVLFIVGVLMSVVTCAWIWMTSLAALIAFAVLFGVFSGGLVPLGSACVAQTAPDMNHIGLRIGAM
MAVTSVGALGAGPVSGTLRDSAGGWVAVHSFAASLSMLGAMMLFAVRCWYKPRLLASF*
Coding >Hirsu2|3909
ATGCCTCCTGCAAATCCCGACAGACTGCGTGACGTGCCTACAGAGCCTGGGCCCGGACCCGGACCCGTGTTGCGG
CAAGAAGCCGGCGGCGACCAGTACCTCGCGTCGACGACGCCTACGCTACAAGACGCCATCAGGACGACCGAGGTC
GAACCCAAGCCCGACCCGGACTCGATCGCCTCATCCGCCGCCTGCCCGAAGCCCGTGGCCGAGGAGAAGGCCTGG
GCCGTCGACGAGAGGCCGGCCTTTTCCCTCTGCAGCTCTCCCATCAAGGAAAGCAGCGGCGCGAACCCGGTCATC
GCCTCCAGTGGCGGCCTCCGCGGCTGGCTCGTCGTCGCCGGCGGCTTCATCGACTTCACCGTTGCCTTTGGCCTG
CTCAACTCGTTCGGAACGTTCCAGGCTCGCTACGAGGAGAAATGGTCACATCTCAGCACCACGACCATTACTTGG
ATCGGTAGCATCCAGCTGTGTCTGTTCTTCCTCGGCGGCCTGTTCGTCGGTCCGGCCTTCGACAAGTATGGATCG
CGATGCCTGATGCAGCTGGGCACGGCCTTTTGCCTCGCCTCCTTCGTCTGCACCAGCTGGTCCACCCAATATTGG
CACTACCTCCTGGCCCAGGGCCTTCTTTTCGGCGTCGGCAATGCCTTGTTATTCTACCCGGCCACCGGCGCCATT
TCCGGATGGTTCAACGAGAAACGCGGGCTCGCGCTCGGAATCGCCGTCTCCGGCTCCTCGCTCGGCGGCGTCTTC
TGGCCCGTCATCATCGACAGGCTCTTCGACGTGATGGAGGAAGAGGTCGTCCATCGCATCATCGCCCTCATCTCC
ACCCCGCTCCTCGTCCTCTCCTGCTTCCTCGTCAGGGAACGTCCGGAGGAGCCCGGCCAGGACGGCGGCCAAGGC
CACGGCCAAGGCCAGGGCCAGTCGCTGAAGACGAGCCTGATCGCGGCCCTGTGCGAGCGGCGATTCCTCGCGCTG
AGCGTCAGCCTCATGATTCTCAACGCTGGCATGCTGATTCCCTTCTTCTACATCCCGCTCTACTCGCAAGAACAA
GGCATCGACGCGACCATGGCGAACAACCTCTTGGCCATCACCTACTCCGGCTCCTTCTTTAGTCGGATCGCGGCC
GGTTGGCTGGCGGACAAGTTCGGCAGGTTCAACGTCTTGTTCATCGTCGGCGTCCTCATGAGCGTCGTCACCTGC
GCCTGGATATGGATGACGTCGCTGGCGGCCCTGATCGCCTTCGCCGTCCTCTTCGGCGTCTTCTCCGGCGGCCTG
GTGCCCCTGGGCTCGGCGTGTGTGGCGCAGACGGCGCCCGACATGAACCACATCGGCCTCCGCATAGGCGCCATG
ATGGCCGTCACTTCTGTCGGCGCGCTGGGGGCCGGGCCCGTCAGCGGCACCTTGAGGGACAGCGCGGGCGGCTGG
GTCGCCGTCCACTCCTTTGCCGCCTCCCTTTCCATGCTGGGCGCCATGATGCTCTTCGCCGTCCGGTGTTGGTAT
AAGCCCCGTCTGCTGGCGAGTTTCTAG
Transcript >Hirsu2|3909
ATGCCTCCTGCAAATCCCGACAGACTGCGTGACGTGCCTACAGAGCCTGGGCCCGGACCCGGACCCGTGTTGCGG
CAAGAAGCCGGCGGCGACCAGTACCTCGCGTCGACGACGCCTACGCTACAAGACGCCATCAGGACGACCGAGGTC
GAACCCAAGCCCGACCCGGACTCGATCGCCTCATCCGCCGCCTGCCCGAAGCCCGTGGCCGAGGAGAAGGCCTGG
GCCGTCGACGAGAGGCCGGCCTTTTCCCTCTGCAGCTCTCCCATCAAGGAAAGCAGCGGCGCGAACCCGGTCATC
GCCTCCAGTGGCGGCCTCCGCGGCTGGCTCGTCGTCGCCGGCGGCTTCATCGACTTCACCGTTGCCTTTGGCCTG
CTCAACTCGTTCGGAACGTTCCAGGCTCGCTACGAGGAGAAATGGTCACATCTCAGCACCACGACCATTACTTGG
ATCGGTAGCATCCAGCTGTGTCTGTTCTTCCTCGGCGGCCTGTTCGTCGGTCCGGCCTTCGACAAGTATGGATCG
CGATGCCTGATGCAGCTGGGCACGGCCTTTTGCCTCGCCTCCTTCGTCTGCACCAGCTGGTCCACCCAATATTGG
CACTACCTCCTGGCCCAGGGCCTTCTTTTCGGCGTCGGCAATGCCTTGTTATTCTACCCGGCCACCGGCGCCATT
TCCGGATGGTTCAACGAGAAACGCGGGCTCGCGCTCGGAATCGCCGTCTCCGGCTCCTCGCTCGGCGGCGTCTTC
TGGCCCGTCATCATCGACAGGCTCTTCGACGTGATGGAGGAAGAGGTCGTCCATCGCATCATCGCCCTCATCTCC
ACCCCGCTCCTCGTCCTCTCCTGCTTCCTCGTCAGGGAACGTCCGGAGGAGCCCGGCCAGGACGGCGGCCAAGGC
CACGGCCAAGGCCAGGGCCAGTCGCTGAAGACGAGCCTGATCGCGGCCCTGTGCGAGCGGCGATTCCTCGCGCTG
AGCGTCAGCCTCATGATTCTCAACGCTGGCATGCTGATTCCCTTCTTCTACATCCCGCTCTACTCGCAAGAACAA
GGCATCGACGCGACCATGGCGAACAACCTCTTGGCCATCACCTACTCCGGCTCCTTCTTTAGTCGGATCGCGGCC
GGTTGGCTGGCGGACAAGTTCGGCAGGTTCAACGTCTTGTTCATCGTCGGCGTCCTCATGAGCGTCGTCACCTGC
GCCTGGATATGGATGACGTCGCTGGCGGCCCTGATCGCCTTCGCCGTCCTCTTCGGCGTCTTCTCCGGCGGCCTG
GTGCCCCTGGGCTCGGCGTGTGTGGCGCAGACGGCGCCCGACATGAACCACATCGGCCTCCGCATAGGCGCCATG
ATGGCCGTCACTTCTGTCGGCGCGCTGGGGGCCGGGCCCGTCAGCGGCACCTTGAGGGACAGCGCGGGCGGCTGG
GTCGCCGTCCACTCCTTTGCCGCCTCCCTTTCCATGCTGGGCGCCATGATGCTCTTCGCCGTCCGGTGTTGGTAT
AAGCCCCGTCTGCTGGCGAGTTTCTAG
Gene >Hirsu2|3909
ATGCCTCCTGCAAATCCCGACAGACTGCGTGACGTGCCTACAGAGCCTGGGCCCGGACCCGGACCCGTGTTGCGG
CAAGAAGCCGGCGGCGACCAGTACCTCGCGTCGACGACGCCTACGCTACAAGACGCCATCAGGACGACCGAGGTC
GAACCCAAGCCCGACCCGGACTCGATCGCCTCATCCGCCGCCTGCCCGAAGCCCGTGGCCGAGGAGAAGGCCTGG
GCCGTCGACGAGAGGCCGGCCTTTTCCCTCTGCAGCTCTCCCATCAAGGAAAGCAGCGGCGCGAACCCGGTCATC
GCCTCCAGTGGCGGCCTCCGCGGCTGGCTCGTCGTCGCCGGCGGCTTCATCGACTTCACCGTTGCCTTTGGTAAC
TATTGGTTTTTTTTTTTTTTCCACCATTTTCTCCTTCTCCCGCCGCACAAAACCCTGCCGGCGCCCATTTCTTGG
CGGACCCCACTAACGGGCCGCGAAAAGGCCTGCTCAACTCGTTCGGAACGTTCCAGGCTCGCTACGAGGAGAAAT
GGTCACATCTCAGCACCACGACCATTACTTGGATCGGTAGCATCCAGGTGAGTCGGTGCAGGCCTGTGGGGGGCG
GCCGGAAGAATGTCGTCAAAAACTTCGCGCGCGTGCAGGCTGACGACGGACGGGCTCGCCTAGCTGTGTCTGTTC
TTCCTCGGCGGCCTGTTCGTCGGTCCGGCCTTCGACAAGTATGGATCGCGATGCCTGATGCAGCTGGGCACGGCC
TTTTGCCTCGCCTCCTTCGTCTGCACCAGCTGGTCCACCCAATATTGGCACTACCTCCTGGCCCAGGGCCTTCTT
TTCGGCGTCGGCAATGCCTTGTTGTGCGTGCTGCCGAACCGTCCAGGCCTCGTTGCCGTCGCATTCTCCCTAACC
TCCCCCCCCTCGGCAGATTCTACCCGGCCACCGGCGCCATTTCCGGATGGTTCAACGAGAAACGCGGGCTCGCGC
TCGGAATCGCCGTCTCCGGCTCCTCGCTCGGCGGCGTCTTCTGGCCCGTCATCATCGACAGGCTCTTCGACGTGA
TGGAGGAAGAGGTCGTCCATCGCATCATCGCCCTCATCTCCACCCCGCTCCTCGTCCTCTCCTGCTTCCTCGTCA
GGGAACGTCCGGAGGAGCCCGGCCAGGACGGCGGCCAAGGCCACGGCCAAGGCCAGGGCCAGTCGCTGAAGACGA
GCCTGATCGCGGCCCTGTGCGAGCGGCGATTCCTCGCGCTGAGCGTCAGCCTCATGATTCTCAACGCTGGCATGC
TGATTCCCTTCTTCTACATCCCGCTCTACTCGCAAGAACAAGGCATCGACGCGACCATGGCGAACAACCTCTTGG
CCATCACCTACTCCGGCTCCTTCTTTAGTCGGATCGCGGCCGGTTGGCTGGCGGACAAGTTCGGCAGGTAAGCAC
CACCCTCCCTCTCCTTTACTGCCGAGGAGCAAAGACCCTCTGCTGCCGAGGCGCAAAGAGGACGCCGGCGGCTGA
CGCGTGCCGGCCCAGGTTCAACGTCTTGTTCATCGTCGGCGTCCTCATGAGCGTCGTCACCTGCGCCTGGATATG
GATGACGTCGCTGGCGGCCCTGATCGCCTTCGCCGTCCTCTTCGGCGTCTTCTCCGGCGGCCTGGTGCCCCTGGG
CTCGGCGTGTGTGGCGCAGACGGCGCCCGACATGAACCACATCGGCCTCCGCATAGGCGCCATGATGGCCGTCAC
TTCTGTCGGCGCGCTGGGGGCCGGGCCCGTCAGCGGCACCTTGAGGGACAGCGCGGGCGGCTGGGTCGCCGTCCA
CTCCTTTGCCGCCTCCCTTTCCATGCTGGGCGCCATGATGCTCTTCGCCGTCCGGTGTTGGTATAAGCCCCGTCT
GCTGGCGAGTTTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail