Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3901
Gene name
LocationContig_205:17737..19113
Strand-
Gene length (bp)1376
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 1.4E-20 110 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 75 331 3.0E-35
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 100 330 6.0E-35
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 114 321 1.0E-14
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 112 320 4.0E-14
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 103 275 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 75 331 3.0E-35
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 100 330 6.0E-35
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 114 321 1.0E-14
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 112 320 4.0E-14
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 103 275 2.0E-13
sp|P50352|NODB_BRAEL Chitooligosaccharide deacetylase OS=Bradyrhizobium elkanii GN=nodB PE=3 SV=1 115 256 2.0E-11
sp|P02963|NODB_RHIME Chitooligosaccharide deacetylase OS=Rhizobium meliloti (strain 1021) GN=nodB PE=3 SV=3 96 256 6.0E-11
sp|P04675|NODB_BRASP Chitooligosaccharide deacetylase OS=Bradyrhizobium sp. (strain ANU 289) GN=nodB PE=3 SV=2 115 256 7.0E-11
sp|O34798|PDAC_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaC OS=Bacillus subtilis (strain 168) GN=pdaC PE=1 SV=1 114 319 2.0E-10
sp|Q52845|NODB_RHILO Chitooligosaccharide deacetylase OS=Rhizobium loti (strain MAFF303099) GN=nodB PE=3 SV=2 115 256 5.0E-10
sp|P50355|NODB_RHISN Chitooligosaccharide deacetylase OS=Rhizobium sp. (strain NGR234) GN=nodB PE=3 SV=2 104 256 1.0E-09
sp|P04676|NODB_RHILT Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. trifolii GN=nodB PE=3 SV=1 94 200 1.0E-09
sp|Q06702|CDA1_YEAST Chitin deacetylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA1 PE=1 SV=1 104 322 1.0E-09
sp|P50354|NODB_RHIGA Chitooligosaccharide deacetylase OS=Rhizobium galegae GN=nodB PE=3 SV=1 115 256 2.0E-09
sp|O34928|PDAA_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaA OS=Bacillus subtilis (strain 168) GN=pdaA PE=1 SV=1 79 320 3.0E-09
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 92 321 8.0E-09
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 113 310 3.0E-08
sp|P04339|NODB_RHILV Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. viciae GN=nodB PE=3 SV=1 115 256 4.0E-08
sp|P50865|PDAB_BACSU Probable polysaccharide deacetylase PdaB OS=Bacillus subtilis (strain 168) GN=pdaB PE=3 SV=2 115 320 6.0E-08
sp|Q06703|CDA2_YEAST Chitin deacetylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA2 PE=1 SV=1 104 295 9.0E-08
sp|P24150|NODB_RHILP Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. phaseoli GN=nodB PE=3 SV=1 102 256 6.0E-07
sp|Q07740|NODB_AZOC5 Chitooligosaccharide deacetylase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodB PE=3 SV=2 103 255 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1547 0.0694 0.9449 0.1432 0.0497 0.0381 0.2606 0.272 0.3582 0.002

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.999775

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
CE4 2.1E-24 110 248

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup88
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3130
Ophiocordyceps australis 1348a (Ghana) OphauG2|438
Ophiocordyceps australis map64 (Brazil) OphauB2|1465
Ophiocordyceps australis map64 (Brazil) OphauB2|230
Ophiocordyceps camponoti-floridani Ophcf2|03614
Ophiocordyceps camponoti-floridani Ophcf2|06957
Ophiocordyceps camponoti-floridani Ophcf2|05927
Ophiocordyceps camponoti-rufipedis Ophun1|481
Ophiocordyceps camponoti-rufipedis Ophun1|6139
Ophiocordyceps camponoti-rufipedis Ophun1|5221
Ophiocordyceps kimflemingae Ophio5|24
Ophiocordyceps kimflemingae Ophio5|7553
Ophiocordyceps kimflemingae Ophio5|7800
Ophiocordyceps subramaniannii Hirsu2|960
Ophiocordyceps subramaniannii Hirsu2|5438
Ophiocordyceps subramaniannii Hirsu2|3901 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3901
MEIGSVKFWTLLLCLVVRLGPVHADGSHALVARGAPSCGATSQHQSKCPGACCSKSGHCGTDMRYCGAGCQKEYS
DKCDEPTGPGGAETANIPRPHLGKVPYGENIKTCNRKGVVALTYDDGPIVNSTLPLLDILKKNGVRATFFVSGFN
KNKGSIDDEKTGYPATLRRTLAEGHQIAAHTWSHPDLNQLATDGNNKILKAEFMFLEMALRNVFGWFPTYMRAPR
LRCDKKPGCLDFAKKWGYHVIHTNLNTKDWSIKDAAGLKSSKQIIRESLAKDPRENSWIIEFHDTLKDTTHQLAK
FVIQEARRQNYEFVTVGDCLDDPKENWYRSAADGAAQTPGADETKLPGPAPEKDAAAEAKKTTCTTSQAAEKKGT
APAPAPDAHSCVCKPCPACPVCPS*
Coding >Hirsu2|3901
ATGGAGATCGGCTCAGTCAAGTTTTGGACACTTCTCCTGTGCCTGGTCGTTCGGCTCGGACCCGTCCACGCAGAC
GGCTCGCACGCGCTCGTGGCCCGAGGCGCGCCGAGCTGTGGCGCCACAAGTCAACACCAGAGCAAATGCCCCGGC
GCCTGTTGCTCCAAGAGCGGCCACTGTGGAACAGACATGCGATACTGCGGCGCCGGTTGCCAGAAGGAATATAGC
GACAAGTGTGATGAACCCACCGGGCCCGGAGGAGCCGAGACGGCAAACATCCCCCGGCCTCATCTCGGAAAGGTT
CCCTACGGAGAGAATATCAAGACCTGCAACAGGAAGGGCGTCGTGGCCCTCACCTACGACGATGGGCCGATTGTC
AACAGCACGCTGCCGCTCCTGGACATCCTCAAGAAGAACGGCGTGCGCGCAACCTTCTTCGTGTCCGGCTTCAAC
AAGAACAAGGGCAGCATCGACGACGAAAAGACCGGATATCCCGCCACGCTCAGGCGCACCCTGGCCGAGGGCCAC
CAGATCGCCGCCCACACCTGGTCGCACCCGGACCTGAACCAGCTGGCGACGGACGGCAACAACAAGATCCTAAAG
GCCGAGTTCATGTTCCTCGAGATGGCCCTCCGCAACGTCTTCGGCTGGTTCCCGACCTACATGCGGGCCCCGCGC
CTGCGCTGCGACAAGAAGCCCGGCTGCCTCGACTTTGCCAAGAAATGGGGATACCACGTCATCCACACCAACCTG
AACACCAAGGACTGGTCCATCAAGGACGCGGCCGGCCTGAAGAGCTCGAAGCAGATCATCAGGGAGTCGCTGGCC
AAAGACCCGCGCGAAAACAGCTGGATCATCGAGTTCCACGACACGCTGAAGGACACCACCCACCAGCTGGCCAAG
TTCGTCATCCAGGAGGCCAGGAGACAAAATTACGAGTTCGTCACCGTCGGAGACTGTCTCGATGACCCCAAGGAG
AACTGGTATCGCTCCGCAGCCGACGGGGCCGCCCAGACCCCTGGCGCCGACGAGACGAAGCTCCCCGGTCCGGCA
CCCGAGAAGGACGCTGCTGCAGAAGCCAAGAAAACTACTTGCACAACTTCGCAGGCGGCTGAGAAGAAAGGCACG
GCCCCGGCCCCGGCCCCGGACGCACACTCGTGCGTTTGCAAACCCTGCCCAGCTTGCCCGGTCTGCCCGTCGTAG
Transcript >Hirsu2|3901
ATGGAGATCGGCTCAGTCAAGTTTTGGACACTTCTCCTGTGCCTGGTCGTTCGGCTCGGACCCGTCCACGCAGAC
GGCTCGCACGCGCTCGTGGCCCGAGGCGCGCCGAGCTGTGGCGCCACAAGTCAACACCAGAGCAAATGCCCCGGC
GCCTGTTGCTCCAAGAGCGGCCACTGTGGAACAGACATGCGATACTGCGGCGCCGGTTGCCAGAAGGAATATAGC
GACAAGTGTGATGAACCCACCGGGCCCGGAGGAGCCGAGACGGCAAACATCCCCCGGCCTCATCTCGGAAAGGTT
CCCTACGGAGAGAATATCAAGACCTGCAACAGGAAGGGCGTCGTGGCCCTCACCTACGACGATGGGCCGATTGTC
AACAGCACGCTGCCGCTCCTGGACATCCTCAAGAAGAACGGCGTGCGCGCAACCTTCTTCGTGTCCGGCTTCAAC
AAGAACAAGGGCAGCATCGACGACGAAAAGACCGGATATCCCGCCACGCTCAGGCGCACCCTGGCCGAGGGCCAC
CAGATCGCCGCCCACACCTGGTCGCACCCGGACCTGAACCAGCTGGCGACGGACGGCAACAACAAGATCCTAAAG
GCCGAGTTCATGTTCCTCGAGATGGCCCTCCGCAACGTCTTCGGCTGGTTCCCGACCTACATGCGGGCCCCGCGC
CTGCGCTGCGACAAGAAGCCCGGCTGCCTCGACTTTGCCAAGAAATGGGGATACCACGTCATCCACACCAACCTG
AACACCAAGGACTGGTCCATCAAGGACGCGGCCGGCCTGAAGAGCTCGAAGCAGATCATCAGGGAGTCGCTGGCC
AAAGACCCGCGCGAAAACAGCTGGATCATCGAGTTCCACGACACGCTGAAGGACACCACCCACCAGCTGGCCAAG
TTCGTCATCCAGGAGGCCAGGAGACAAAATTACGAGTTCGTCACCGTCGGAGACTGTCTCGATGACCCCAAGGAG
AACTGGTATCGCTCCGCAGCCGACGGGGCCGCCCAGACCCCTGGCGCCGACGAGACGAAGCTCCCCGGTCCGGCA
CCCGAGAAGGACGCTGCTGCAGAAGCCAAGAAAACTACTTGCACAACTTCGCAGGCGGCTGAGAAGAAAGGCACG
GCCCCGGCCCCGGCCCCGGACGCACACTCGTGCGTTTGCAAACCCTGCCCAGCTTGCCCGGTCTGCCCGTCGTAG
Gene >Hirsu2|3901
ATGGAGATCGGCTCAGTCAAGTTTTGGACACTTCTCCTGTGCCTGGTCGTTCGGCTCGGACCCGTCCACGCAGAC
GGCTCGCACGCGCTCGTGGCCCGAGGCGCGCCGAGCTGTGGCGCCACAAGTCAACACCAGAGCAAATGCCCCGGC
GCCTGTTGCTCCAAGAGCGGCCACTGTGGAACAGACATGCGATACTGCGGCGCCGGTTGCCAGAAGGAATATAGC
GACAAGTGTGATGAACCGTGAGTTTGAAATCTTCGCGCCAGGCAGGCCGACGTTAGTCTCGGAGCAGCCACTTGC
TAACGAGGTCGTGTCAGCACCGGGCCCGGAGGAGCCGAGACGGCAAACATCCCCCGGCCTCATCTCGGAAAGGTT
CCCTACGGTATGTTGAGCTCGTCCGGGCTGATGGTCCTTTGCGGAACGGAGAGGACACGGGGGTCGAGGGGCTTC
GAGAGCTGAGTCGAGCCCATCGGGCCGTGATAGGAGAGAATATCAAGACCTGCAACAGGAAGGGCGTCGTGGCCC
TCACCTACGACGATGGGCCGATTGTCAACAGCACGCTGCCGCTCCTGGACATCCTCAAGAAGAACGGCGTGCGCG
CAACCTTCTTCGTGTCCGGCTTCAACAAGAACAAGGGCAGCATCGACGACGAAAAGACCGGATATCCCGCCACGC
TCAGGCGCACCCTGGCCGAGGGCCACCAGATCGCCGCCCACACCTGGTCGCACCCGGACCTGAACCAGCTGGCGA
CGGACGGCAACAACAAGATCCTAAAGGCCGAGTTCATGTTCCTCGAGATGGCCCTCCGCAACGTCTTCGGCTGGT
TCCCGACCTACATGCGGGCCCCGCGCCTGCGCTGCGACAAGAAGCCCGGCTGCCTCGACTTTGCCAAGAAATGGG
GATACCACGTCATCCACACCAACCTGAACACCAAGGACTGGTCCATCAAGGACGCGGCCGGCCTGAAGAGCTCGA
AGCAGATCATCAGGGAGTCGCTGGCCAAAGACCCGCGCGAAAACAGCTGGATCATCGAGTTCCACGACACGCTGA
AGGACACCACCCACCAGCTGGCCAAGTTCGTCATCCAGGAGGCCAGGAGACAAAATTACGAGTTCGTCACCGTCG
GAGACTGTCTCGATGACCCCAAGGAGAACTGGTATCGCTCCGCAGCCGACGGGGCCGCCCAGACCCCTGGCGCCG
ACGAGACGAAGCTCCCCGGTCCGGCACCCGAGAAGGACGCTGCTGCAGAAGCCAAGAAAACTACTTGCACAACTT
CGCAGGCGGCTGAGAAGAAAGGCACGGCCCCGGCCCCGGCCCCGGACGCACACTCGTGCGTTTGCAAACCCTGCC
CAGCTTGCCCGGTCTGCCCGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail