Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3895
Gene name
LocationContig_205:114..719
Strand+
Gene length (bp)605
Transcript length (bp)486
Coding sequence length (bp)486
Protein length (aa) 162

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2917 0.0787 0.9312 0.2563 0.1388 0.2527 0.124 0.318 0.351 0.0195

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.58838

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup9456
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|3895 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3895
MLNTLARVVVLAVALGASLVGAGKSRLPPRSLRKTTRRPDPAEQERQLLDKRASAQCNSARARIVGALRDTGKSV
DKIQDAQVKSAAQAGLDQANGGVADIAKSIVKGQDPPADSRDTVAAGLKATNDALGSGKSGDAAVAAAQKSVGEA
AAAGQDVLDQC*
Coding >Hirsu2|3895
ATGCTTAATACACTGGCTCGCGTCGTCGTCCTCGCCGTCGCCCTCGGCGCATCCCTCGTCGGCGCCGGTAAGTCC
CGCCTGCCACCCCGATCCCTCCGCAAGACGACGAGGCGGCCGGACCCTGCCGAGCAGGAGCGCCAACTGCTCGAC
AAGCGAGCCAGCGCCCAATGCAACAGTGCCCGGGCCCGCATCGTCGGCGCCCTGCGCGACACGGGCAAGTCGGTC
GATAAGATACAGGACGCCCAGGTCAAGTCGGCCGCCCAGGCCGGCCTCGATCAGGCCAATGGCGGCGTCGCCGAC
ATTGCGAAGTCTATTGTCAAGGGCCAGGATCCGCCCGCCGATTCGCGCGACACGGTCGCGGCAGGCCTCAAGGCC
ACCAACGACGCCCTCGGCTCCGGCAAAAGCGGCGATGCCGCCGTCGCGGCCGCCCAGAAGTCGGTGGGCGAGGCC
GCCGCCGCGGGACAGGACGTCCTGGATCAGTGCTGA
Transcript >Hirsu2|3895
ATGCTTAATACACTGGCTCGCGTCGTCGTCCTCGCCGTCGCCCTCGGCGCATCCCTCGTCGGCGCCGGTAAGTCC
CGCCTGCCACCCCGATCCCTCCGCAAGACGACGAGGCGGCCGGACCCTGCCGAGCAGGAGCGCCAACTGCTCGAC
AAGCGAGCCAGCGCCCAATGCAACAGTGCCCGGGCCCGCATCGTCGGCGCCCTGCGCGACACGGGCAAGTCGGTC
GATAAGATACAGGACGCCCAGGTCAAGTCGGCCGCCCAGGCCGGCCTCGATCAGGCCAATGGCGGCGTCGCCGAC
ATTGCGAAGTCTATTGTCAAGGGCCAGGATCCGCCCGCCGATTCGCGCGACACGGTCGCGGCAGGCCTCAAGGCC
ACCAACGACGCCCTCGGCTCCGGCAAAAGCGGCGATGCCGCCGTCGCGGCCGCCCAGAAGTCGGTGGGCGAGGCC
GCCGCCGCGGGACAGGACGTCCTGGATCAGTGCTGA
Gene >Hirsu2|3895
ATGCTTAATACACTGGCTCGCGTCGTCGTCCTCGCCGTCGCCCTCGGCGCATCCCTCGTCGGCGCCGGTAAGTCC
CGCCTGCCACCCCGATCCCTCCGCAAGACGACGAGGCGGCCGGACCCTGCCGAGCAGGAGCGGTGCGTGTTGAAT
CGAGACATAACAATCAATGCACGATAGGCCCCGTGCCCAGCAGCCAACTGCTCGACAAGCGAGCCAGCGCCCAAT
GCAACAGTGCCCGGGCCCGCATCGTCGGCGCCCTGCGCGACACGGGCAAGTCGGTCGATAAGATACAGGACGCCC
AGGTCAAGTCGGCCGCCCAGGCCGGCCTCGATCAGGCCAATGGCGGCGTCGCCGACATTGCGAAGTCTATTGTCA
AGGGCCAGGATCCGCCCGCCGATTCGCGCGACACGGTCGCGGCAGGCCTCAAGGCCACCAACGACGCCCTCGGCT
CCGGCAAAAGGTGCGCTCGGGACGGCCCTCCCTCCCCTCCCGTGCTGGCGACGGCATGCTGACCTCCATCAAGCG
GCGATGCCGCCGTCGCGGCCGCCCAGAAGTCGGTGGGCGAGGCCGCCGCCGCGGGACAGGACGTCCTGGATCAGT
GCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail