Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3891
Gene name
LocationContig_2047:111..1518
Strand-
Gene length (bp)1407
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00622 SPRY SPRY domain 2.3E-18 158 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UB6|SSH4_NEUCR Protein ssh4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ssh4 PE=3 SV=2 3 356 0.0E+00
sp|A1CNW8|SSH4_ASPCL Protein ssh4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ssh4 PE=3 SV=1 14 357 4.0E-178
sp|Q4WRW0|SSH4_ASPFU Protein ssh4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ssh4 PE=3 SV=2 13 314 8.0E-178
sp|Q1E2D2|SSH4_COCIM Protein SSH4 OS=Coccidioides immitis (strain RS) GN=SSH4 PE=3 SV=1 13 358 4.0E-177
sp|A1D1S7|SSH4_NEOFI Protein ssh4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ssh4 PE=3 SV=1 13 314 1.0E-176
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UB6|SSH4_NEUCR Protein ssh4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ssh4 PE=3 SV=2 3 356 0.0E+00
sp|A1CNW8|SSH4_ASPCL Protein ssh4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ssh4 PE=3 SV=1 14 357 4.0E-178
sp|Q4WRW0|SSH4_ASPFU Protein ssh4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ssh4 PE=3 SV=2 13 314 8.0E-178
sp|Q1E2D2|SSH4_COCIM Protein SSH4 OS=Coccidioides immitis (strain RS) GN=SSH4 PE=3 SV=1 13 358 4.0E-177
sp|A1D1S7|SSH4_NEOFI Protein ssh4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ssh4 PE=3 SV=1 13 314 1.0E-176
sp|A7EQ00|SSH4_SCLS1 Protein ssh4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ssh4 PE=3 SV=1 9 324 1.0E-174
sp|A6S3E0|SSH4_BOTFB Protein ssh4 OS=Botryotinia fuckeliana (strain B05.10) GN=ssh4 PE=3 SV=1 9 324 4.0E-174
sp|O74497|YCRA_SCHPO SPRY domain-containing protein C285.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC285.10c PE=3 SV=1 5 329 7.0E-87
sp|Q03212|EAR1_YEAST Protein EAR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAR1 PE=1 SV=1 109 318 1.0E-54
sp|A6ZZJ6|SSH4_YEAS7 Protein SSH4 OS=Saccharomyces cerevisiae (strain YJM789) GN=SSH4 PE=3 SV=1 39 314 9.0E-39
sp|P32343|SSH4_YEAST Protein SSH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSH4 PE=1 SV=2 39 314 9.0E-39
sp|Q6FJG2|SSH4_CANGA Protein SSH4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSH4 PE=3 SV=1 39 262 2.0E-37
sp|Q6BSU1|SSH4_DEBHA Protein SSH4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SSH4 PE=3 SV=2 15 314 4.0E-36
sp|A7TE03|SSH4_VANPO Protein SSH4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SSH4 PE=3 SV=1 39 262 4.0E-34
sp|Q6CVE0|SSH4_KLULA Protein SSH4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSH4 PE=3 SV=1 46 266 4.0E-29
sp|Q28FM1|RANB9_XENTR Ran-binding protein 9 OS=Xenopus tropicalis GN=ranbp9 PE=2 SV=1 144 287 5.0E-19
sp|Q9PTY5|RANB9_XENLA Ran-binding protein 9 OS=Xenopus laevis GN=ranbp9 PE=2 SV=1 144 287 6.0E-19
sp|A3KMV8|RBP10_BOVIN Ran-binding protein 10 OS=Bos taurus GN=RANBP10 PE=2 SV=1 144 287 1.0E-17
sp|Q6VN20|RBP10_HUMAN Ran-binding protein 10 OS=Homo sapiens GN=RANBP10 PE=1 SV=1 144 296 2.0E-17
sp|A1L252|RANB9_DANRE Ran-binding protein 9 OS=Danio rerio GN=ranbp9 PE=2 SV=1 144 287 2.0E-17
sp|Q6VN19|RBP10_MOUSE Ran-binding protein 10 OS=Mus musculus GN=Ranbp10 PE=1 SV=2 144 287 2.0E-17
sp|P69566|RANB9_MOUSE Ran-binding protein 9 OS=Mus musculus GN=Ranbp9 PE=1 SV=1 144 287 3.0E-17
sp|Q96S59|RANB9_HUMAN Ran-binding protein 9 OS=Homo sapiens GN=RANBP9 PE=1 SV=1 144 287 4.0E-17
sp|Q1LUS8|RBP10_DANRE Ran-binding protein 10 OS=Danio rerio GN=ranbp10 PE=3 SV=1 144 287 8.0E-17
sp|Q4Z8K6|RBP9X_DROME Ran-binding proteins 9/10 homolog OS=Drosophila melanogaster GN=RanBPM PE=1 SV=1 144 279 9.0E-12
sp|O94712|YC5C_SCHPO Uncharacterized protein C1259.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1259.12c PE=3 SV=2 144 279 2.0E-11
sp|Q5RBR6|SPRY3_PONAB SPRY domain-containing protein 3 OS=Pongo abelii GN=SPRYD3 PE=2 SV=1 143 288 3.0E-11
sp|Q8NCJ5|SPRY3_HUMAN SPRY domain-containing protein 3 OS=Homo sapiens GN=SPRYD3 PE=1 SV=2 143 288 3.0E-11
sp|Q8NCJ5|SPRY3_HUMAN SPRY domain-containing protein 3 OS=Homo sapiens GN=SPRYD3 PE=1 SV=2 152 227 4.0E-08
sp|Q5RBR6|SPRY3_PONAB SPRY domain-containing protein 3 OS=Pongo abelii GN=SPRYD3 PE=2 SV=1 152 227 4.0E-07
sp|P18160|SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum GN=splA PE=1 SV=3 173 266 5.0E-07
sp|Q6FJG2|SSH4_CANGA Protein SSH4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSH4 PE=3 SV=1 268 314 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3891
MAVVTAPSSAFTGIIIGLVSSFGSIILIALVVFIFWASGCAGSGRILLDRLGRPGEYDDEQAFARDEAEALETMD
DMARTEYLRAKAFVTANPPESVQTDISLSQYLAIQEKGVSAWEFEPELEIANCFVEARTEIEFFDSECTVMSNLP
VPKQNDVYYWEAKIYDKPEHTLLAIGMATKPYPLFRLPGYHKYSVAYHSDGSRHHNQPFSRTPYGPQLVQGDVVG
VGYRPRTGAIFFTRNGKRLEEVAHGLKSQNFFPAIGANGPAVVHVNLGQSGFVFIEANVKKWGLAPVTGSLAPPP
PYGSEQGSILLESGTKDGGAPSGHALSHRHWCRATRWARPAAARRRRRRRRSGTARAG*
Coding >Hirsu2|3891
ATGGCCGTCGTCACGGCTCCCTCGTCCGCCTTCACCGGCATCATCATCGGCCTCGTCTCCTCCTTCGGCTCCATC
ATCCTCATCGCCCTCGTCGTCTTCATCTTCTGGGCCTCGGGATGTGCCGGCTCCGGCCGCATCCTGCTCGACCGC
CTCGGCCGCCCCGGCGAGTACGACGATGAGCAGGCCTTTGCCAGGGACGAGGCCGAGGCCCTCGAGACCATGGAC
GACATGGCCCGCACCGAATATCTCAGGGCCAAGGCCTTCGTCACGGCCAACCCTCCCGAGTCCGTCCAGACGGAC
ATTTCGCTCTCGCAATACCTGGCCATCCAAGAAAAGGGCGTCTCCGCGTGGGAGTTCGAGCCCGAGCTGGAAATC
GCAAACTGCTTCGTCGAGGCCCGCACCGAAATCGAATTCTTCGACTCGGAGTGCACCGTCATGAGCAACCTGCCC
GTCCCCAAGCAGAACGACGTCTACTACTGGGAGGCCAAGATCTACGACAAGCCCGAACACACGCTGCTCGCCATT
GGCATGGCCACCAAGCCCTATCCGCTATTCCGCCTACCCGGTTACCACAAGTACTCGGTCGCATACCACTCGGAC
GGCTCGCGCCACCACAACCAGCCCTTTAGCCGCACGCCGTACGGGCCGCAGCTGGTCCAGGGCGACGTGGTCGGC
GTCGGCTACCGGCCCCGGACCGGCGCCATCTTCTTCACCCGCAACGGCAAGAGGCTGGAGGAGGTGGCGCACGGG
CTCAAGTCGCAAAACTTCTTCCCCGCCATCGGCGCCAACGGCCCGGCCGTCGTCCACGTCAACCTCGGCCAGTCG
GGCTTCGTCTTCATCGAGGCCAACGTCAAGAAGTGGGGCCTGGCCCCCGTCACCGGCAGCCTCGCGCCGCCGCCT
CCCTACGGCTCCGAGCAGGGTAGCATCCTCCTCGAGTCGGGCACCAAGGACGGTGGCGCCCCGTCCGGCCACGCC
CTGTCCCACCGCCACTGGTGCCGAGCGACGAGGTGGGCGAGGCCAGCGGCAGCGCGGCGGCGGCGGCGGCGGCGG
CGCAGCGGCACCGCGAGGGCCGGATGA
Transcript >Hirsu2|3891
ATGGCCGTCGTCACGGCTCCCTCGTCCGCCTTCACCGGCATCATCATCGGCCTCGTCTCCTCCTTCGGCTCCATC
ATCCTCATCGCCCTCGTCGTCTTCATCTTCTGGGCCTCGGGATGTGCCGGCTCCGGCCGCATCCTGCTCGACCGC
CTCGGCCGCCCCGGCGAGTACGACGATGAGCAGGCCTTTGCCAGGGACGAGGCCGAGGCCCTCGAGACCATGGAC
GACATGGCCCGCACCGAATATCTCAGGGCCAAGGCCTTCGTCACGGCCAACCCTCCCGAGTCCGTCCAGACGGAC
ATTTCGCTCTCGCAATACCTGGCCATCCAAGAAAAGGGCGTCTCCGCGTGGGAGTTCGAGCCCGAGCTGGAAATC
GCAAACTGCTTCGTCGAGGCCCGCACCGAAATCGAATTCTTCGACTCGGAGTGCACCGTCATGAGCAACCTGCCC
GTCCCCAAGCAGAACGACGTCTACTACTGGGAGGCCAAGATCTACGACAAGCCCGAACACACGCTGCTCGCCATT
GGCATGGCCACCAAGCCCTATCCGCTATTCCGCCTACCCGGTTACCACAAGTACTCGGTCGCATACCACTCGGAC
GGCTCGCGCCACCACAACCAGCCCTTTAGCCGCACGCCGTACGGGCCGCAGCTGGTCCAGGGCGACGTGGTCGGC
GTCGGCTACCGGCCCCGGACCGGCGCCATCTTCTTCACCCGCAACGGCAAGAGGCTGGAGGAGGTGGCGCACGGG
CTCAAGTCGCAAAACTTCTTCCCCGCCATCGGCGCCAACGGCCCGGCCGTCGTCCACGTCAACCTCGGCCAGTCG
GGCTTCGTCTTCATCGAGGCCAACGTCAAGAAGTGGGGCCTGGCCCCCGTCACCGGCAGCCTCGCGCCGCCGCCT
CCCTACGGCTCCGAGCAGGGTAGCATCCTCCTCGAGTCGGGCACCAAGGACGGTGGCGCCCCGTCCGGCCACGCC
CTGTCCCACCGCCACTGGTGCCGAGCGACGAGGTGGGCGAGGCCAGCGGCAGCGCGGCGGCGGCGGCGGCGGCGG
CGCAGCGGCACCGCGAGGGCCGGATGA
Gene >Hirsu2|3891
ATGGCCGTCGTCACGGCTCCCTCGTCCGCCTTCACCGGCATCATCATCGGCCTCGTCTCCTCCTTCGGCTCCATC
ATCCTCATCGCCCTCGTCGTCTTCATCTTCTGGGCCTCGGGATGTGCCGGCTCCGGCCGCATCCTGCTCGACCGC
CTCGGCCGCCCCGGCGAGTACGACGATGAGCAGGCCTTTGCCAGGGACGAGGCCGAGGCCCTCGAGACCATGGAC
GACATGGCCCGCACCGAATATCTCAGGGCCAAGGGTACGTTGCCGCTGCCCATCTGCTCGCCCCAAACTTCCTCT
CCTCCGCACAGCCCTCGGAAACGTCGACTGACACGTGCGCTTCCGCCCCCTCCCGCCTTGCAGCCTTCGTCACGG
CCAACCCTCCCGAGTCCGTCCAGACGGACATTTCGCTCTCGCAATACCTGGCCATCCAAGAAAAGGGCGTCTCCG
CGTGGGAGTTCGAGCCCGAGCTGGAAATCGCAAACTGCTTCGTCGAGGCCCGCACCGAAATCGAATTCTTCGACT
CGGAGTGCACCGTCATGAGCAACCTGCCCGTCCCCAAGCAGAACGACGTCTACTACTGGGAGGCCAAGATCTACG
ACAAGCCCGAACACACGCTGCTCGCCATTGGCATGGCCACCAAGCCCTATCCGCTATTCCGCCTACCCGGTGAGC
AGAATCCCCCCTTCCGCTGTCGGTGGTCCGCCGTCTGACGCGCGCCTCGTCTCCCTCCTCCTCCCCTCCCAGGTT
ACCACAAGTACTCGGTCGCATACCACTCGGACGGCTCGCGCCACCACAACCAGCCCTTTAGCCGCACGCCGTACG
GGCCGCAGCTGGTCCAGGGCGACGTGGTCGGCGTCGGCTACCGGCCCCGGACCGGCGCCATCTTCTTCACCCGCA
ACGGCAAGAGGCTGGAGGAGGTGGCGCACGGGCTCAAGTCGCAAAACTTCTTCCCCGCCATCGGCGCCAACGGCC
CGGCCGTCGTCCACGTCAACCTCGGCCAGTCGGGCTTCGTCTTCATCGAGGCCAACGTCAAGAAGTGGGGCCTGG
CCCCCGTCACCGGCAGCCTCGCGCCGCCGCCTCCCTACGGCTCCGAGCAGGGTAGCATCCTCCTCGAGTCGGGCA
CCAAGGACGGTGGCGCCCCGTCCGGCCACGCCCTGTCCCACCGCCAGTCCATCAGCGGCTCGCCCTTCCACGCCC
ACCTGGCCGGGGCCACCATGGGCGCTCAGCACGGGCGCTCGCGAAGCGGCAACTTCAGAGTGCTCCCTCCCACGA
GCCCCGGCCCCGTCAGAAGCCCGACTGACATCTCGCTCGCCCAGCTGGTGCCGAGCGACGAGGTGGGCGAGGCCA
GCGGCAGCGCGGCGGCGGCGGCGGCGGCGGCGCAGCGGCACCGCGAGGGCCGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail