Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3879
Gene name
LocationContig_204:23518..24555
Strand+
Gene length (bp)1037
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 2.1E-58 72 286

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8ZI10|RSB1_YEAS8 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RSB1 PE=3 SV=1 36 293 1.0E-22
sp|C7GLH7|RSB1_YEAS2 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RSB1 PE=3 SV=2 36 293 3.0E-22
sp|B3LJA1|RSB1_YEAS1 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSB1 PE=3 SV=2 36 293 4.0E-22
sp|A6ZNQ4|RSB1_YEAS7 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RSB1 PE=3 SV=2 36 293 5.0E-22
sp|B5VRU8|RSB1_YEAS6 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSB1 PE=3 SV=1 36 293 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8ZI10|RSB1_YEAS8 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RSB1 PE=3 SV=1 36 293 1.0E-22
sp|C7GLH7|RSB1_YEAS2 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RSB1 PE=3 SV=2 36 293 3.0E-22
sp|B3LJA1|RSB1_YEAS1 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSB1 PE=3 SV=2 36 293 4.0E-22
sp|A6ZNQ4|RSB1_YEAS7 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RSB1 PE=3 SV=2 36 293 5.0E-22
sp|B5VRU8|RSB1_YEAS6 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSB1 PE=3 SV=1 36 293 5.0E-22
sp|Q08417|RSB1_YEAST Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSB1 PE=1 SV=3 36 293 5.0E-22
sp|O13780|YEO2_SCHPO Uncharacterized protein C17G6.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.02c PE=4 SV=1 30 250 1.0E-15
sp|P53047|RTA1_YEAST Protein RTA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTA1 PE=1 SV=1 29 249 9.0E-15
sp|P40113|RTM1_YEASX Protein RTM1 OS=Saccharomyces cerevisiae GN=RTM1 PE=3 SV=1 28 249 6.0E-13
sp|P40100|PUG1_YEAST Protoporphyrin uptake protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUG1 PE=1 SV=1 74 212 2.0E-07
sp|Q12253|YL046_YEAST Uncharacterized membrane protein YLR046C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR046C PE=1 SV=1 63 206 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 39 61 22
3 66 88 22
4 95 117 22
5 145 167 22
6 179 201 22
7 221 240 19
8 261 283 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3879
MGSLPELPGHLVVFGPGANCTLALCPVEWSVYTYRPSLAANVAFLVLFGAAAGVHVVAGVGWGSCWFAFFNVLGC
VVEMAGYAGRVVLHGNPWSFGGFMVQIVFITTGPVFYTAAIYVTLSQVSLACVSSVEHLGPELSRFRSSLFYWVF
IPADLVCLVLQAAGGALSSISVGSSTTGVHVAMAGLALQAATVFLFSAFFADYVIRYVYDVSTLPLSPRIRLFFG
GLGVATVLILVRSVYRCYELSKGYRHSDLIRDQGLFIGLEGVVVVIAVFALCIGHPGLIFSPEAKADPAENNESS
EEKA*
Coding >Hirsu2|3879
ATGGGCTCGCTGCCGGAGCTCCCCGGCCACCTCGTCGTCTTCGGCCCGGGCGCCAACTGCACTCTGGCGCTGTGC
CCCGTCGAGTGGAGCGTCTACACGTACCGGCCGTCGCTGGCGGCCAACGTCGCCTTTCTCGTGCTCTTTGGTGCC
GCTGCCGGCGTCCACGTCGTCGCCGGCGTCGGCTGGGGGAGCTGCTGGTTCGCCTTCTTCAACGTCTTGGGCTGC
GTGGTCGAGATGGCGGGCTACGCCGGCCGCGTCGTCCTGCACGGCAACCCGTGGTCCTTTGGGGGCTTCATGGTG
CAGATTGTCTTCATCACGACCGGGCCGGTCTTTTACACGGCCGCCATCTACGTTACTCTGTCCCAGGTAAGCCTT
GCGTGCGTCTCCAGCGTCGAGCACCTCGGGCCCGAGCTCTCCCGCTTCAGGTCCAGCCTCTTCTACTGGGTCTTC
ATCCCCGCGGACCTCGTCTGCCTCGTCCTGCAGGCGGCCGGAGGCGCGCTCTCCAGCATCAGCGTCGGCTCGAGC
ACCACGGGCGTCCACGTCGCCATGGCTGGCCTGGCCCTGCAGGCGGCCACTGTCTTCCTCTTCTCCGCCTTCTTC
GCCGACTACGTGATCCGCTACGTGTATGACGTGTCGACGCTGCCGCTCAGCCCCAGGATCCGCCTTTTCTTCGGC
GGTCTCGGCGTCGCCACCGTGCTCATTCTCGTGCGGTCCGTCTACCGGTGCTACGAGCTGAGCAAGGGCTACAGG
CATTCAGACCTGATAAGGGACCAGGGCCTGTTCATCGGGCTCGAGGGAGTTGTCGTCGTCATCGCCGTCTTTGCC
CTGTGTATCGGACACCCGGGGCTGATATTCAGTCCCGAGGCCAAGGCTGATCCGGCCGAGAACAATGAGAGCTCT
GAAGAGAAGGCATAG
Transcript >Hirsu2|3879
ATGGGCTCGCTGCCGGAGCTCCCCGGCCACCTCGTCGTCTTCGGCCCGGGCGCCAACTGCACTCTGGCGCTGTGC
CCCGTCGAGTGGAGCGTCTACACGTACCGGCCGTCGCTGGCGGCCAACGTCGCCTTTCTCGTGCTCTTTGGTGCC
GCTGCCGGCGTCCACGTCGTCGCCGGCGTCGGCTGGGGGAGCTGCTGGTTCGCCTTCTTCAACGTCTTGGGCTGC
GTGGTCGAGATGGCGGGCTACGCCGGCCGCGTCGTCCTGCACGGCAACCCGTGGTCCTTTGGGGGCTTCATGGTG
CAGATTGTCTTCATCACGACCGGGCCGGTCTTTTACACGGCCGCCATCTACGTTACTCTGTCCCAGGTAAGCCTT
GCGTGCGTCTCCAGCGTCGAGCACCTCGGGCCCGAGCTCTCCCGCTTCAGGTCCAGCCTCTTCTACTGGGTCTTC
ATCCCCGCGGACCTCGTCTGCCTCGTCCTGCAGGCGGCCGGAGGCGCGCTCTCCAGCATCAGCGTCGGCTCGAGC
ACCACGGGCGTCCACGTCGCCATGGCTGGCCTGGCCCTGCAGGCGGCCACTGTCTTCCTCTTCTCCGCCTTCTTC
GCCGACTACGTGATCCGCTACGTGTATGACGTGTCGACGCTGCCGCTCAGCCCCAGGATCCGCCTTTTCTTCGGC
GGTCTCGGCGTCGCCACCGTGCTCATTCTCGTGCGGTCCGTCTACCGGTGCTACGAGCTGAGCAAGGGCTACAGG
CATTCAGACCTGATAAGGGACCAGGGCCTGTTCATCGGGCTCGAGGGAGTTGTCGTCGTCATCGCCGTCTTTGCC
CTGTGTATCGGACACCCGGGGCTGATATTCAGTCCCGAGGCCAAGGCTGATCCGGCCGAGAACAATGAGAGCTCT
GAAGAGAAGGCATAG
Gene >Hirsu2|3879
ATGGGCTCGCTGCCGGAGCTCCCCGGCCACCTCGTCGTCTTCGGCCCGGGCGCCAACTGCACTCTGGCGCTGTGC
CCCGTCGAGTGGAGCGTCTACACGTACCGGCCGTCGCTGGCGGCCAACGTCGCCTTTCTCGTGCTCTTTGGTGCC
GCTGCCGGCGTCCACGTCGTCGCCGGCGTCGGCTGGGGGAGCTGCTGGTTCGCCTTCTTCAACGTCTTGGGCTGC
GTGGTCGAGATGGCGGGCTACGCCGGCCGCGTCGTCCTGCACGGCAACCCGTGGTCCTTTGGGGGCTTCATGGTG
CAGATTGTCTTCATCACGACCGGGCCGGTCTTTTACACGGCCGCCATCTACGTTACTCTGTCCCAGGTGTAAGTG
TCGCTGCCATTGACCGCACACCATGTCCGACGGCCGTCCGGCTTAGAAGCCTTGCGTGCGTCTCCAGCGTCGAGC
ACCTCGGGCCCGAGCTCTCCCGCTTCAGGTCCAGCCTCTTCTACTGGGTCTTCATCCCCGCGGACCTCGTCTGCC
TCGTCCTGCAGGCGGCCGGAGGCGCGCTCTCCAGCATCAGCGTCGGCTCGAGCACCACGGGCGTCCACGTCGCCA
TGGCTGGCCTGGCCCTGCAGGCGGCCACTGTCTTCCTCTTCTCCGCCTTCTTCGCCGACTACGTGATCCGCTACG
TGTATGACGTGTCGACGCTGCCGCTCAGCCCCAGGATCCGCCTTTTCTTCGGCGGTCTCGGCGTCGCCACCGTGC
TCATTCTCGTGCGGTCCGTCTACCGGTGCTACGAGCTGAGCAAGGGCTACAGGCATTCAGACCTGATAAGGGACC
AGGGCCTGTTCATCGGGCTCGAGGGAGTGTATGCAACCCATCGCCCGTGCCCGGCAGTTCGAGTAGATATGGAGG
GGGCTGTGCTGACTCCGTGCAGTGTCGTCGTCATCGCCGTCTTTGCCCTGTGTATCGGACACCCGGGGCTGATAT
TCAGTCCCGAGGCCAAGGCTGATCCGGCCGAGAACAATGAGAGCTCTGAAGAGAAGGCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail