Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3874
Gene name
LocationContig_204:13029..14580
Strand+
Gene length (bp)1551
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 5.9E-68 134 377
PF10348 DUF2427 Domain of unknown function (DUF2427) 4.4E-30 8 106

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53584|YTP1_YEAST Protein YTP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTP1 PE=1 SV=1 135 426 4.0E-68
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 117 285 7.0E-09
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 191 346 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 49 71 22
3 81 103 22
4 124 146 22
5 161 183 22
6 254 271 17
7 281 303 22
8 316 338 22
9 353 375 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3874
MADSKISAGDTVSQEPIDTILWIHIFTQMLAYGVIFPIGMVFGMTKSRWHVPTQISGSVLALLGFVLGHAHGGRE
FVGGNVHSGFATILQLLLIAQVVLGLYLKGHWEKGLNGRLRRFIRPCHSIIGKAMPVLSWTQMIFGGITALGFCQ
SDHLGQCLAHFIMGSAFIAYGILMAIILVVGQVWMRRTGRSQEFFDSAVIAAWGCVNTFTEHRWGSAWVRNDWQH
TTMGIIWWCAGLAGMWLSRDRDGNPKRNFIPGFVIFMTGWAMSAHPQSLMTSAMTHSMFGKTLMAAGVTRIIEIA
FVLKDKQSLSDNGRSWNSFQYLPVFLMYASGFLFMGATEEQMLLIEASDLDHVSYILILYSLAFMVFLFSNMLVN
LYDRLANPADSKDMGNGHACVGGRGMEEGRLRDAGDFELDGLMSDDEGDENRRMLSRSEDGSSLDTPTTLGKNNE
SSAH*
Coding >Hirsu2|3874
ATGGCCGACAGCAAGATCTCCGCCGGGGACACCGTCTCCCAAGAACCCATCGATACGATCCTATGGATCCACATC
TTCACCCAGATGCTCGCCTATGGCGTCATCTTCCCCATCGGAATGGTCTTTGGCATGACCAAGTCTCGGTGGCAT
GTCCCGACGCAAATTTCCGGCTCCGTCCTGGCTCTTCTCGGCTTCGTCCTCGGCCATGCACACGGGGGCCGTGAG
TTCGTCGGCGGCAACGTCCACTCTGGCTTCGCCACCATACTCCAGCTGCTCCTCATCGCTCAGGTCGTCCTCGGC
CTTTATCTCAAGGGCCACTGGGAGAAGGGGCTCAACGGCAGACTCCGAAGATTCATCCGGCCTTGCCACTCCATC
ATTGGCAAGGCCATGCCTGTCCTGTCCTGGACTCAGATGATTTTCGGCGGCATCACCGCCCTGGGTTTCTGCCAG
AGCGACCACCTGGGCCAGTGCTTGGCCCATTTCATCATGGGCAGTGCCTTCATCGCCTATGGCATCCTCATGGCA
ATCATCCTCGTCGTCGGCCAAGTCTGGATGCGCCGCACCGGGCGCTCGCAAGAATTCTTTGACAGTGCCGTCATC
GCCGCCTGGGGCTGCGTCAACACCTTCACCGAGCACCGATGGGGCAGCGCCTGGGTGAGGAACGATTGGCAGCAC
ACGACCATGGGAATCATCTGGTGGTGCGCTGGCCTGGCAGGCATGTGGCTCAGCCGGGATCGTGACGGGAACCCG
AAGCGCAACTTTATACCAGGCTTCGTCATCTTCATGACCGGCTGGGCCATGTCGGCGCATCCCCAGTCTCTCATG
ACGAGCGCCATGACGCATAGCATGTTTGGCAAGACGTTGATGGCTGCCGGTGTGACTCGCATCATTGAAATAGCC
TTCGTTCTGAAGGACAAGCAGTCCCTCTCGGACAATGGCCGTTCCTGGAACAGCTTCCAGTATCTCCCTGTTTTT
CTTATGTACGCCTCGGGCTTCCTGTTCATGGGGGCAACAGAGGAGCAAATGCTCCTGATCGAGGCCTCCGATCTC
GACCACGTCTCGTATATCCTGATTCTCTACTCGCTTGCCTTCATGGTTTTCCTCTTCAGCAACATGCTTGTTAAC
CTGTACGACCGTCTGGCCAACCCTGCCGACTCGAAAGATATGGGCAATGGACATGCTTGTGTTGGCGGCCGCGGC
ATGGAAGAGGGCCGACTCCGGGACGCCGGCGATTTCGAGCTGGATGGCTTGATGAGCGACGACGAGGGGGACGAG
AATCGCCGCATGCTGAGTCGGAGTGAGGACGGATCCAGTCTGGATACCCCGACCACACTCGGAAAAAATAACGAG
TCGTCGGCGCATTGA
Transcript >Hirsu2|3874
ATGGCCGACAGCAAGATCTCCGCCGGGGACACCGTCTCCCAAGAACCCATCGATACGATCCTATGGATCCACATC
TTCACCCAGATGCTCGCCTATGGCGTCATCTTCCCCATCGGAATGGTCTTTGGCATGACCAAGTCTCGGTGGCAT
GTCCCGACGCAAATTTCCGGCTCCGTCCTGGCTCTTCTCGGCTTCGTCCTCGGCCATGCACACGGGGGCCGTGAG
TTCGTCGGCGGCAACGTCCACTCTGGCTTCGCCACCATACTCCAGCTGCTCCTCATCGCTCAGGTCGTCCTCGGC
CTTTATCTCAAGGGCCACTGGGAGAAGGGGCTCAACGGCAGACTCCGAAGATTCATCCGGCCTTGCCACTCCATC
ATTGGCAAGGCCATGCCTGTCCTGTCCTGGACTCAGATGATTTTCGGCGGCATCACCGCCCTGGGTTTCTGCCAG
AGCGACCACCTGGGCCAGTGCTTGGCCCATTTCATCATGGGCAGTGCCTTCATCGCCTATGGCATCCTCATGGCA
ATCATCCTCGTCGTCGGCCAAGTCTGGATGCGCCGCACCGGGCGCTCGCAAGAATTCTTTGACAGTGCCGTCATC
GCCGCCTGGGGCTGCGTCAACACCTTCACCGAGCACCGATGGGGCAGCGCCTGGGTGAGGAACGATTGGCAGCAC
ACGACCATGGGAATCATCTGGTGGTGCGCTGGCCTGGCAGGCATGTGGCTCAGCCGGGATCGTGACGGGAACCCG
AAGCGCAACTTTATACCAGGCTTCGTCATCTTCATGACCGGCTGGGCCATGTCGGCGCATCCCCAGTCTCTCATG
ACGAGCGCCATGACGCATAGCATGTTTGGCAAGACGTTGATGGCTGCCGGTGTGACTCGCATCATTGAAATAGCC
TTCGTTCTGAAGGACAAGCAGTCCCTCTCGGACAATGGCCGTTCCTGGAACAGCTTCCAGTATCTCCCTGTTTTT
CTTATGTACGCCTCGGGCTTCCTGTTCATGGGGGCAACAGAGGAGCAAATGCTCCTGATCGAGGCCTCCGATCTC
GACCACGTCTCGTATATCCTGATTCTCTACTCGCTTGCCTTCATGGTTTTCCTCTTCAGCAACATGCTTGTTAAC
CTGTACGACCGTCTGGCCAACCCTGCCGACTCGAAAGATATGGGCAATGGACATGCTTGTGTTGGCGGCCGCGGC
ATGGAAGAGGGCCGACTCCGGGACGCCGGCGATTTCGAGCTGGATGGCTTGATGAGCGACGACGAGGGGGACGAG
AATCGCCGCATGCTGAGTCGGAGTGAGGACGGATCCAGTCTGGATACCCCGACCACACTCGGAAAAAATAACGAG
TCGTCGGCGCATTGA
Gene >Hirsu2|3874
ATGGCCGACAGCAAGATCTCCGCCGGGGACACCGTCTCCCAAGAACCCATCGTGAGCACTCTGCCGCCGACCAGC
CCTCGCCGCCTGCTTGTGCTGACGGATACTCGCAGGATACGATCCTATGGATCCACATCTTCACCCAGATGCTCG
CCTATGGCGTCATCTTCCCCATCGGAATGGTCTTTGGCGTAGGTGTATCCCGCTTCGGCGACGCCAAGGAGAGCA
AGACCGCTGACAGCCGCTCCCTTTTCCCGACAGATGACCAAGTCTCGGTGGCATGTCCCGACGCAAATTTCCGGC
TCCGTCCTGGCTCTTCTCGGCTTCGTCCTCGGCCATGCACACGGGGGCCGTGAGTTCGTCGGCGGCAACGTCCAC
TCTGGCTTCGCCACCATACTCCAGCTGCTCCTCATCGCTCAGGTCGTCCTCGGCCTTTATCTCAAGGGCCACTGG
GAGAAGGGGCTCAACGGCAGACTCCGAAGATTCATCCGGCCTTGCCACTCCATCATTGGCAAGGCCATGCCTGTC
CTGTCCTGGACTCAGATGATTTTCGGCGGCATCACCGCCCTGGGTTTCTGCCAGAGCGACCACCTGGGCCAGTGC
TTGGCCCATTTCATCATGGGCAGTGCCTTCATCGCCTATGGCATCCTCATGGCAATCATCCTCGTCGTCGGCCAA
GTCTGGATGCGCCGCACCGGGCGCTCGCAAGAATTCTTTGACAGTGCCGTCATCGCCGCCTGGGGCTGCGTCAAC
ACCTTCACCGAGCACCGATGGGGCAGCGCCTGGGTGAGGAACGATTGGCAGCACACGACCATGGGAATCATCTGG
TGGTGCGCTGGCCTGGCAGGCATGTGGCTCAGCCGGGATCGTGACGGGAACCCGAAGCGCAACTTTATACCAGGC
TTCGTCATCTTCATGACCGGCTGGGCCATGTCGGCGCATCCCCAGTCTCTCATGACGAGCGCCATGACGCATAGC
ATGTTTGGCAAGACGTTGATGGCTGCCGGTGTGACTCGCATCATTGAAATAGCCTTCGTTCTGAAGGACAAGCAG
TCCCTCTCGGACAATGGCCGTTCCTGGAACAGCTTCCAGTATCTCCCTGTTTTTGTGAGTCTTCTCATCGTCAGA
GGCCCGATAGGTGACCAAGTACTGACGTGTTCCCAGCTTATGTACGCCTCGGGCTTCCTGTTCATGGGGGCAACA
GAGGAGCAAATGCTCCTGATCGAGGCCTCCGATCTCGACCACGTCTCGTATATCCTGATTCTCTACTCGCTTGCC
TTCATGGTTTTCCTCTTCAGCAACATGCTTGTTAACCTGTACGACCGTCTGGCCAACCCTGCCGACTCGAAAGAT
ATGGGCAATGGACATGCTTGTGTTGGCGGCCGCGGCATGGAAGAGGGCCGACTCCGGGACGCCGGCGATTTCGAG
CTGGATGGCTTGATGAGCGACGACGAGGGGGACGAGAATCGCCGCATGCTGAGTCGGAGTGAGGACGGATCCAGT
CTGGATACCCCGACCACACTCGGAAAAAATAACGAGTCGTCGGCGCATTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail