Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3857
Gene name
LocationContig_2030:1443..3398
Strand-
Gene length (bp)1955
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-37 86 454

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 9 529 3.0E-96
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 49 528 9.0E-84
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 2 527 2.0E-73
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 51 528 7.0E-73
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 47 528 8.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 9 529 3.0E-96
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 49 528 9.0E-84
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 2 527 2.0E-73
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 51 528 7.0E-73
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 47 528 8.0E-66
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 23 529 2.0E-63
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 43 524 8.0E-53
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 2 468 4.0E-45
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 73 527 1.0E-35
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 72 527 2.0E-34
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 47 499 2.0E-31
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 16 522 1.0E-30
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 56 527 2.0E-30
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 76 412 5.0E-29
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 65 358 7.0E-29
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 72 529 2.0E-26
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 72 386 3.0E-25
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 17 393 6.0E-25
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 65 285 6.0E-24
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 24 525 1.0E-21
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 71 327 7.0E-21
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 71 394 3.0E-19
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 68 486 5.0E-19
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 2 392 7.0E-17
sp|Q9SDI4|PHT41_ORYSJ Probable anion transporter 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PHT4;1 PE=2 SV=1 80 317 1.0E-10
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 71 452 2.0E-10
sp|Q8GX78|ANTR2_ARATH Ascorbate transporter, chloroplastic OS=Arabidopsis thaliana GN=PHT4;4 PE=1 SV=1 80 349 1.0E-09
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 157 272 3.0E-09
sp|Q652N5|PHT44_ORYSJ Probable anion transporter 4, chloroplastic OS=Oryza sativa subsp. japonica GN=PHT4;4 PE=2 SV=1 80 374 1.0E-08
sp|O82390|ANTR1_ARATH Sodium-dependent phosphate transport protein 1, chloroplastic OS=Arabidopsis thaliana GN=ANTR1 PE=1 SV=1 80 315 2.0E-07
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 71 342 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 119 141 22
3 146 168 22
4 173 195 22
5 208 230 22
6 240 262 22
7 314 336 22
8 346 368 22
9 375 394 19
10 404 426 22
11 438 457 19
12 472 494 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3857
MSSSSVGEEKMGQHDVDVRHLASSSSSETPARAPPASGFDDAPRPASGAVDAAWKFLDDHRDARGVDAVDLKALR
RKIDWHIVPLMFCCYTMQFLDKVILNYAAVMGISKDLSLKGNDFSNIATFLFVGLLCFEIPNIYFLQKFPAAKWL
GFNVTFWGVATACGAAARNYPTLLASRIFLGIFEATIGPSLMLISSQWYTKSEQAPRFSFWYLGLGLGQIIGGAV
SYAFQHVAPGAGLAGWRVMFLLLGVLTVLFGLCTFFFLPDTPMQAPWLSSTEKVALLKHVSVNQTGIQSRTFRPK
EIVEALLDPQIWLLILSVVLLSVSSGVVTTYSATLIKNLGYNPKQAALMNMPSGVVSIFFTLLVGFGIRKQSHRW
AWIIACIIPAILGGALMSFLNPHSNRSGVLAGIYLVNAVVAPLTIFYNWTVANCAGGTKRALASALVSGSFSLGN
IIGPQTFQARDAPDFRPAKLAVMGTQAGCALTTFALFLYYVWANKRRNDRSRQQEESFMSPDVWASMTDKENKHF
RYTY*
Coding >Hirsu2|3857
ATGTCTTCCTCGTCCGTGGGCGAAGAGAAGATGGGCCAGCACGACGTCGACGTCCGCCACCTCGCCTCGTCCTCC
TCGAGCGAAACGCCGGCCCGGGCCCCGCCGGCCTCCGGCTTCGACGATGCCCCGCGCCCGGCCTCCGGCGCCGTC
GACGCCGCCTGGAAGTTCCTCGACGACCACCGCGACGCCCGGGGCGTCGACGCCGTCGACCTCAAGGCCCTGCGC
CGCAAGATCGACTGGCACATCGTCCCGCTCATGTTCTGCTGCTACACCATGCAGTTCCTCGACAAAGTTATCCTC
AACTACGCCGCCGTCATGGGCATCAGCAAGGACCTGTCGCTCAAGGGCAACGACTTCTCCAACATAGCCACCTTT
CTCTTCGTCGGCCTCCTCTGCTTCGAGATCCCCAACATCTACTTCCTCCAAAAGTTCCCGGCCGCCAAGTGGCTC
GGCTTCAACGTCACCTTCTGGGGCGTGGCGACGGCGTGCGGCGCCGCGGCGCGCAACTACCCGACGCTGCTGGCG
TCGCGCATCTTCCTCGGCATCTTCGAGGCCACCATCGGGCCGTCGCTCATGCTCATCAGCAGCCAGTGGTACACC
AAGTCGGAGCAGGCCCCGCGCTTCTCCTTCTGGTACCTCGGCCTCGGCCTCGGCCAGATCATCGGCGGCGCCGTC
TCGTACGCCTTCCAGCACGTCGCCCCGGGCGCCGGCCTGGCCGGCTGGCGCGTCATGTTCCTCCTCCTCGGCGTC
CTCACCGTCCTCTTCGGCCTCTGCACCTTCTTCTTCCTGCCCGACACCCCGATGCAGGCCCCCTGGCTGTCGAGC
ACGGAGAAGGTGGCGCTGCTCAAGCACGTCAGCGTCAACCAGACCGGCATCCAGAGCCGCACGTTCCGCCCCAAG
GAGATCGTCGAGGCCCTGCTCGACCCCCAGATCTGGCTGCTCATCCTGTCCGTCGTCCTCCTGTCCGTCTCGAGC
GGCGTCGTCACCACCTACTCCGCCACCCTCATCAAGAACCTCGGCTACAACCCCAAGCAGGCCGCCCTCATGAAC
ATGCCCTCCGGCGTCGTCAGCATCTTCTTCACCCTCCTCGTCGGCTTCGGCATCCGCAAGCAGTCCCACCGCTGG
GCCTGGATCATCGCCTGCATCATTCCTGCAATCCTCGGCGGCGCCCTCATGTCCTTCCTGAACCCCCACTCCAAC
CGGTCTGGCGTCCTGGCCGGCATCTACCTCGTTAATGCCGTCGTCGCCCCCCTGACCATCTTCTACAACTGGACC
GTCGCCAACTGCGCCGGCGGCACCAAGCGCGCCTTGGCCTCCGCTCTCGTCAGCGGCTCCTTCTCGCTCGGCAAC
ATCATCGGGCCCCAGACCTTCCAGGCCCGCGACGCGCCCGACTTCCGCCCGGCCAAGCTGGCCGTCATGGGCACC
CAGGCCGGCTGCGCCCTCACCACCTTCGCCCTCTTCCTCTACTACGTCTGGGCCAACAAGCGCCGCAACGACCGC
AGCAGGCAGCAGGAGGAGTCCTTCATGTCCCCCGACGTCTGGGCCTCGATGACGGACAAGGAGAACAAGCACTTC
CGATACACGTACTAG
Transcript >Hirsu2|3857
ATGTCTTCCTCGTCCGTGGGCGAAGAGAAGATGGGCCAGCACGACGTCGACGTCCGCCACCTCGCCTCGTCCTCC
TCGAGCGAAACGCCGGCCCGGGCCCCGCCGGCCTCCGGCTTCGACGATGCCCCGCGCCCGGCCTCCGGCGCCGTC
GACGCCGCCTGGAAGTTCCTCGACGACCACCGCGACGCCCGGGGCGTCGACGCCGTCGACCTCAAGGCCCTGCGC
CGCAAGATCGACTGGCACATCGTCCCGCTCATGTTCTGCTGCTACACCATGCAGTTCCTCGACAAAGTTATCCTC
AACTACGCCGCCGTCATGGGCATCAGCAAGGACCTGTCGCTCAAGGGCAACGACTTCTCCAACATAGCCACCTTT
CTCTTCGTCGGCCTCCTCTGCTTCGAGATCCCCAACATCTACTTCCTCCAAAAGTTCCCGGCCGCCAAGTGGCTC
GGCTTCAACGTCACCTTCTGGGGCGTGGCGACGGCGTGCGGCGCCGCGGCGCGCAACTACCCGACGCTGCTGGCG
TCGCGCATCTTCCTCGGCATCTTCGAGGCCACCATCGGGCCGTCGCTCATGCTCATCAGCAGCCAGTGGTACACC
AAGTCGGAGCAGGCCCCGCGCTTCTCCTTCTGGTACCTCGGCCTCGGCCTCGGCCAGATCATCGGCGGCGCCGTC
TCGTACGCCTTCCAGCACGTCGCCCCGGGCGCCGGCCTGGCCGGCTGGCGCGTCATGTTCCTCCTCCTCGGCGTC
CTCACCGTCCTCTTCGGCCTCTGCACCTTCTTCTTCCTGCCCGACACCCCGATGCAGGCCCCCTGGCTGTCGAGC
ACGGAGAAGGTGGCGCTGCTCAAGCACGTCAGCGTCAACCAGACCGGCATCCAGAGCCGCACGTTCCGCCCCAAG
GAGATCGTCGAGGCCCTGCTCGACCCCCAGATCTGGCTGCTCATCCTGTCCGTCGTCCTCCTGTCCGTCTCGAGC
GGCGTCGTCACCACCTACTCCGCCACCCTCATCAAGAACCTCGGCTACAACCCCAAGCAGGCCGCCCTCATGAAC
ATGCCCTCCGGCGTCGTCAGCATCTTCTTCACCCTCCTCGTCGGCTTCGGCATCCGCAAGCAGTCCCACCGCTGG
GCCTGGATCATCGCCTGCATCATTCCTGCAATCCTCGGCGGCGCCCTCATGTCCTTCCTGAACCCCCACTCCAAC
CGGTCTGGCGTCCTGGCCGGCATCTACCTCGTTAATGCCGTCGTCGCCCCCCTGACCATCTTCTACAACTGGACC
GTCGCCAACTGCGCCGGCGGCACCAAGCGCGCCTTGGCCTCCGCTCTCGTCAGCGGCTCCTTCTCGCTCGGCAAC
ATCATCGGGCCCCAGACCTTCCAGGCCCGCGACGCGCCCGACTTCCGCCCGGCCAAGCTGGCCGTCATGGGCACC
CAGGCCGGCTGCGCCCTCACCACCTTCGCCCTCTTCCTCTACTACGTCTGGGCCAACAAGCGCCGCAACGACCGC
AGCAGGCAGCAGGAGGAGTCCTTCATGTCCCCCGACGTCTGGGCCTCGATGACGGACAAGGAGAACAAGCACTTC
CGATACACGTACTAG
Gene >Hirsu2|3857
ATGTCTTCCTCGTCCGTGGGCGAAGAGAAGATGGGCCAGCACGACGTCGACGTCCGCCACCTCGCCTCGTCCTCC
TCGAGCGAAACGCCGGCCCGGGCCCCGCCGGCCTCCGGCTTCGACGATGCCCCGCGCCCGGCCTCCGGCGCCGTC
GACGCCGCCTGGAAGTTCCTCGACGACCACCGCGACGCCCGGGGCGTCGACGCCGTCGACCTCAAGGCCCTGCGC
CGCAAGATCGACTGGCACATCGTCCCGCTCATGTTCTGCTGCTACACCATGCAGTTCCTCGACAAAGTTATCCTC
AACGTCCGTCTTCTCTCATCATCTCTTCCCCCCTTTTCCCTATTGCTTTCTCTCCTCGCCTTGCGCTGACGCCGA
CTCGACCGTGGAAACCTACAGTACGCCGCCGTCATGGGCATCAGCAAGGACCTGTCGCTCAAGGGCAACGACTTC
TCCAACATAGCCACCTTTCTCTTCGTCGGCCTCCTCTGCTTCGAGATCCCCAACAGTGCGTCGTCCTCTCTCTCT
CTCTCTCTCTACCTCCCCCGTCTCGCCGCCTTGTACCGCGCCCGTCCGTCCCGAGATTCTTGGTCTGACGCTCCG
TCGAAATCCCGCGCAGTCTACTTCCTCCAAAAGTTCCCGGCCGCCAAGTGGCTCGGCTTCAACGTCACCTTCTGG
GGCGTGGCGACGGCGTGCGGCGCCGCGGCGCGCAACTACCCGACGCTGCTGGCGTCGCGCATCTTCCTCGGCATC
TTCGAGGCCACCATCGGGCCGTCGCTCATGCTCATCAGCAGCCAGTGGTACACCAAGTCGGAGCAGGCCCCGCGC
TTCTCCTTCTGGTACCTCGGCCTCGGCCTCGGCCAGATCATCGGCGGCGCCGTCTCGTACGCCTTCCAGCACGTC
GCCCCGGGCGCCGGCCTGGCCGGCTGGCGCGTCATGTTCCTCCTCCTCGGCGTCCTCACCGTCCTCTTCGGCCTC
TGCACCTTCTTCTTCCTGCCCGACACCCCGATGCAGGCCCCCTGGCTGTCGAGCACGGAGAAGGTGGCGCTGCTC
AAGCACGTCAGCGTCAACCAGACCGGCATCCAGAGCCGCACGTTCCGCCCCAAGGAGATCGTCGAGGCCCTGCTC
GACCCCCAGATCTGGCTGCTCATCCTGTCCGTCGTCCTCCTGTCCGTCTCGAGCGGCGTCGTCACCACCTACTCC
GCCACCCTCATCAAGAACCTCGGCTACAACCCCAAGCAGGCCGCCCTCATGAACATGCCCTCCGGCGTCGTCAGC
ATCTTCTTCACCCTCCTCGTCGGCTTCGGCATCCGCAAGCAGTCCCACCGCTGGGCCTGGATCATCGCCTGCATC
ATTCCTGCGTACGAACCCCGTCCTTCTCCCTCCCCCATCTCACAGGCGCCGTCCGTCTATACATCTATACTGACC
GTCCGTCCGTCTTCTCCAGAATCCTCGGCGGCGCCCTCATGTCCTTCCTGAACCCCCACTCCAACCGGTCTGGCG
TCCTGGCCGGCATCTACCTCGTTAATGCCGTCGTCGCCCCCCTGACCATCTTCTACAACGTACGTCCCTGTTCTT
CCATCCTCTCCTCCCCTGGCAACGTCGGCCGGCTGACTTTCTCTCTCGCCTCTGACCAGTGGACCGTCGCCAACT
GCGCCGGCGGCACCAAGCGCGCCTTGGCCTCCGCTCTCGTCAGCGGCTCCTTCTCGCTCGGCAACATCATCGGGC
CCCAGACCTTCCAGGCCCGCGACGCGCCCGACTTCCGCCCGGCCAAGCTGGCCGTCATGGGCACCCAGGCCGGCT
GCGCCCTCACCACCTTCGCCCTCTTCCTCTACTACGTCTGGGCCAACAAGCGCCGCAACGACCGCAGCAGGCAGC
AGGAGGAGTCCTTCATGTCCCCCGACGTCTGGGCCTCGATGACGGACAAGGAGAACAAGCACTTCCGATACACGT
ACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail