Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3848
Gene name
LocationContig_203:8900..10586
Strand-
Gene length (bp)1686
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-35 21 425
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 2.7E-09 15 434

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 2 508 2.0E-79
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 13 537 2.0E-45
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 13 532 1.0E-42
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 13 442 1.0E-42
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 11 443 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 2 508 2.0E-79
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 13 537 2.0E-45
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 13 532 1.0E-42
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 13 442 1.0E-42
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 11 443 2.0E-42
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 13 388 4.0E-38
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 27 456 3.0E-36
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 9 444 1.0E-33
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 31 500 4.0E-33
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 12 514 2.0E-31
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 12 514 2.0E-31
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 106 443 1.0E-27
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 31 347 1.0E-25
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 4 387 3.0E-23
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 13 322 1.0E-21
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 17 367 4.0E-19
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 14 382 5.0E-19
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 20 193 5.0E-18
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 20 193 5.0E-18
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 17 341 2.0E-17
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 53 491 5.0E-16
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 30 429 2.0E-15
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 17 330 2.0E-15
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 30 429 4.0E-15
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 23 434 1.0E-14
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 8 324 2.0E-14
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 30 239 3.0E-14
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 30 239 4.0E-14
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 27 239 5.0E-14
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 30 239 5.0E-14
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 30 239 5.0E-14
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 30 239 5.0E-14
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 30 239 5.0E-14
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 30 239 5.0E-14
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 30 239 5.0E-14
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 30 239 6.0E-14
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 30 239 1.0E-13
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 22 434 2.0E-13
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 30 348 3.0E-13
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 2 237 6.0E-13
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 12 172 9.0E-13
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 30 348 2.0E-12
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 23 344 2.0E-12
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 21 279 3.0E-12
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 21 279 3.0E-12
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 19 344 3.0E-12
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 19 344 3.0E-12
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 30 230 5.0E-12
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 30 230 5.0E-12
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 30 230 5.0E-12
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 30 230 5.0E-12
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 30 230 5.0E-12
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 30 230 5.0E-12
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 30 230 5.0E-12
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 30 230 5.0E-12
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 30 230 7.0E-12
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 30 181 8.0E-12
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 2 325 1.0E-11
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 4 475 1.0E-11
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 30 230 2.0E-11
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 30 235 2.0E-11
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 30 181 4.0E-11
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 26 348 4.0E-11
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 26 348 4.0E-11
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 30 326 4.0E-11
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 6 458 1.0E-10
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 4 446 1.0E-10
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 21 459 1.0E-10
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 30 364 3.0E-10
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 30 181 3.0E-10
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 54 442 4.0E-10
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 54 442 6.0E-10
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 17 247 5.0E-09
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 13 337 8.0E-09
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 13 337 8.0E-09
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 6 325 2.0E-08
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 6 325 2.0E-08
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 6 218 2.0E-08
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 6 218 2.0E-08
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 6 218 2.0E-08
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 6 218 2.0E-08
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 6 170 4.0E-08
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 22 324 2.0E-07
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 6 218 3.0E-07
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 16 174 5.0E-07
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 30 325 1.0E-06
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 15 386 4.0E-06
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 15 386 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 77 99 22
3 106 128 22
4 138 160 22
5 172 194 22
6 214 236 22
7 243 265 22
8 285 307 22
9 314 336 22
10 346 368 22
11 381 403 22
12 407 429 22
13 485 507 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3848
MSVPAQHQRGGLRLALIMAALCMAVVLTGMDQTILATATPVISNEFRTLQDLGWWTNAYLLTLSSFQLFYGKLYS
LFSIKLVYLAAIAIFEAGTLICTLANNSVTLIIGRAVAGLGAAGIFSGGILITTKIIPLARRAVYLGVMSGAFGL
AAIVGPFLGGVLADRATWRWCFGINLPLGAVTVVLCVLFVHTPVDPSLRSVRMASKMKQLDIPGIVCMVASSICL
LMALQSGGSMWPWSDRRIIALLIFSAVLAVFFVLVQTTSIAGEARTIPPSLSRNRDVWLAAGYAMCTTGGVYVPV
LYLPVWFQTVRGQSALVAGAMLTPLIASYVACSVVAGALTTMTGYYNPGMIIGTALAIAGAAVLTTLNIDASTAR
AVGYQLLYGFGIGFAFGQPSYVVQTLLPEADVPVGVTFITLVQNLSASVFVAVAQSIFQGGLRSRLRQELPGVDL
SPILDSGLSNFRSSLPQDKQLAGLRAFSASLVTTFYISLALSAVSAVGALGIRWVSMKPGYSQAPAETSQTCQQE
EEAGTKERDTNQQ*
Coding >Hirsu2|3848
ATGTCCGTTCCAGCCCAGCATCAGCGCGGTGGGCTCCGACTCGCCCTGATCATGGCCGCGCTCTGCATGGCCGTG
GTCTTGACCGGGATGGACCAGACCATTTTGGCCACCGCGACTCCCGTCATCTCCAACGAGTTCCGGACGCTGCAA
GACCTGGGGTGGTGGACCAACGCCTATCTCCTGACGCTGAGCAGCTTCCAGCTCTTCTACGGGAAGCTGTACAGC
CTCTTCTCCATCAAGCTCGTCTACCTCGCCGCCATCGCCATCTTCGAGGCCGGGACGCTGATCTGCACCTTGGCC
AACAACTCGGTGACGCTCATCATCGGCCGCGCCGTCGCCGGCCTCGGCGCCGCCGGCATCTTCTCGGGCGGCATC
CTCATCACCACCAAGATCATCCCGCTCGCCCGCCGCGCCGTCTACCTGGGGGTCATGTCGGGCGCCTTCGGTCTC
GCCGCCATCGTCGGGCCGTTCCTGGGCGGCGTCCTGGCCGACCGCGCGACGTGGAGATGGTGTTTCGGCATCAAC
TTGCCGCTCGGAGCCGTCACGGTCGTCCTGTGCGTTCTGTTTGTCCACACGCCCGTTGATCCGTCCCTGCGATCG
GTCAGGATGGCCAGCAAGATGAAGCAGCTCGACATACCGGGCATCGTCTGCATGGTCGCGTCGTCGATATGCCTG
CTCATGGCCCTGCAGTCGGGCGGGTCCATGTGGCCGTGGAGCGACAGGCGCATCATCGCCCTGCTCATCTTCTCC
GCCGTCCTGGCCGTCTTCTTCGTTCTCGTCCAGACAACCTCCATCGCCGGTGAGGCTCGCACGATCCCGCCCAGC
CTGAGTCGCAACCGGGACGTTTGGCTCGCGGCAGGCTACGCCATGTGCACCACCGGCGGCGTCTACGTCCCGGTC
CTCTATCTGCCCGTCTGGTTCCAGACGGTGCGCGGGCAGTCGGCTCTCGTGGCCGGCGCGATGCTCACGCCTCTC
ATCGCCAGCTATGTCGCCTGCTCCGTCGTTGCCGGCGCTCTTACGACCATGACTGGCTACTACAATCCGGGCATG
ATCATCGGCACTGCGCTGGCCATTGCCGGGGCAGCGGTCTTGACTACGCTCAACATTGACGCCTCGACAGCCCGT
GCCGTCGGCTATCAGCTGCTCTATGGCTTCGGCATCGGCTTCGCATTCGGCCAGCCCAGCTATGTGGTCCAGACC
TTGCTCCCCGAGGCTGACGTCCCGGTGGGCGTCACATTCATCACCTTGGTCCAGAACCTCAGCGCATCTGTCTTT
GTAGCTGTGGCCCAGAGCATCTTTCAAGGGGGCCTTCGCTCGCGTCTTCGCCAGGAGTTGCCGGGCGTGGACCTC
TCTCCCATCCTCGACTCCGGCTTATCGAATTTCAGGTCATCACTGCCCCAAGACAAGCAGCTTGCTGGCCTTCGA
GCATTCAGCGCATCCCTCGTGACCACGTTCTATATCTCGCTGGCGCTTAGTGCCGTATCTGCCGTCGGGGCCTTG
GGAATAAGATGGGTCTCCATGAAGCCGGGCTACAGTCAAGCACCGGCCGAGACAAGTCAGACATGTCAGCAAGAA
GAGGAGGCGGGGACGAAGGAGAGAGACACCAATCAGCAATAG
Transcript >Hirsu2|3848
ATGTCCGTTCCAGCCCAGCATCAGCGCGGTGGGCTCCGACTCGCCCTGATCATGGCCGCGCTCTGCATGGCCGTG
GTCTTGACCGGGATGGACCAGACCATTTTGGCCACCGCGACTCCCGTCATCTCCAACGAGTTCCGGACGCTGCAA
GACCTGGGGTGGTGGACCAACGCCTATCTCCTGACGCTGAGCAGCTTCCAGCTCTTCTACGGGAAGCTGTACAGC
CTCTTCTCCATCAAGCTCGTCTACCTCGCCGCCATCGCCATCTTCGAGGCCGGGACGCTGATCTGCACCTTGGCC
AACAACTCGGTGACGCTCATCATCGGCCGCGCCGTCGCCGGCCTCGGCGCCGCCGGCATCTTCTCGGGCGGCATC
CTCATCACCACCAAGATCATCCCGCTCGCCCGCCGCGCCGTCTACCTGGGGGTCATGTCGGGCGCCTTCGGTCTC
GCCGCCATCGTCGGGCCGTTCCTGGGCGGCGTCCTGGCCGACCGCGCGACGTGGAGATGGTGTTTCGGCATCAAC
TTGCCGCTCGGAGCCGTCACGGTCGTCCTGTGCGTTCTGTTTGTCCACACGCCCGTTGATCCGTCCCTGCGATCG
GTCAGGATGGCCAGCAAGATGAAGCAGCTCGACATACCGGGCATCGTCTGCATGGTCGCGTCGTCGATATGCCTG
CTCATGGCCCTGCAGTCGGGCGGGTCCATGTGGCCGTGGAGCGACAGGCGCATCATCGCCCTGCTCATCTTCTCC
GCCGTCCTGGCCGTCTTCTTCGTTCTCGTCCAGACAACCTCCATCGCCGGTGAGGCTCGCACGATCCCGCCCAGC
CTGAGTCGCAACCGGGACGTTTGGCTCGCGGCAGGCTACGCCATGTGCACCACCGGCGGCGTCTACGTCCCGGTC
CTCTATCTGCCCGTCTGGTTCCAGACGGTGCGCGGGCAGTCGGCTCTCGTGGCCGGCGCGATGCTCACGCCTCTC
ATCGCCAGCTATGTCGCCTGCTCCGTCGTTGCCGGCGCTCTTACGACCATGACTGGCTACTACAATCCGGGCATG
ATCATCGGCACTGCGCTGGCCATTGCCGGGGCAGCGGTCTTGACTACGCTCAACATTGACGCCTCGACAGCCCGT
GCCGTCGGCTATCAGCTGCTCTATGGCTTCGGCATCGGCTTCGCATTCGGCCAGCCCAGCTATGTGGTCCAGACC
TTGCTCCCCGAGGCTGACGTCCCGGTGGGCGTCACATTCATCACCTTGGTCCAGAACCTCAGCGCATCTGTCTTT
GTAGCTGTGGCCCAGAGCATCTTTCAAGGGGGCCTTCGCTCGCGTCTTCGCCAGGAGTTGCCGGGCGTGGACCTC
TCTCCCATCCTCGACTCCGGCTTATCGAATTTCAGGTCATCACTGCCCCAAGACAAGCAGCTTGCTGGCCTTCGA
GCATTCAGCGCATCCCTCGTGACCACGTTCTATATCTCGCTGGCGCTTAGTGCCGTATCTGCCGTCGGGGCCTTG
GGAATAAGATGGGTCTCCATGAAGCCGGGCTACAGTCAAGCACCGGCCGAGACAAGTCAGACATGTCAGCAAGAA
GAGGAGGCGGGGACGAAGGAGAGAGACACCAATCAGCAATAG
Gene >Hirsu2|3848
ATGTCCGTTCCAGCCCAGCATCAGCGCGGTGGGCTCCGACTCGCCCTGATCATGGCCGCGCTCTGCATGGCCGTG
GTCTTGACCGGGATGGTATTCAGCCAAGCAGCATCGAGCTTGACATGTACCGGAGACGCAGCTGGCTGATACCCC
CGTCTGCAGGACCAGACCATTTTGGCCACCGCGACTCCCGTCATCTCCAACGAGTTCCGGACGCTGCAAGACCTG
GGGTGGTGGACCAACGCCTATCTCCTGACGCTGAGCAGCTTCCAGCTCTTCTACGGGAAGCTGTACAGCCTCTTC
TCCATCAAGCTCGTCTACCTCGCCGCCATCGCCATCTTCGAGGCCGGGACGCTGATCTGCACCTTGGCCAACAAC
TCGGTGACGCTCATCATCGGCCGCGCCGTCGCCGGCCTCGGCGCCGCCGGCATCTTCTCGGGCGGCATCCTCATC
ACCACCAAGATCATCCCGCTCGCCCGCCGCGCCGTCTACCTGGGGGTCATGTCGGGCGCCTTCGGTCTCGCCGCC
ATCGTCGGGCCGTTCCTGGGCGGCGTCCTGGCCGACCGCGCGACGTGGAGATGGTGTTTCGGCATCAACTTGCCG
CTCGGAGCCGTCACGGTCGTCCTGTGCGTTCTGTTTGTCCACACGCCCGTTGATCCGTCCCTGCGATCGGTCAGG
ATGGCCAGCAAGATGAAGCAGCTCGACATACCGGGCATCGTCTGCATGGTCGCGTCGTCGATATGCCTGCTCATG
GCCCTGCAGTCGGGCGGGTCCATGTGGCCGTGGAGCGACAGGCGCATCATCGCCCTGCTCATCTTCTCCGCCGTC
CTGGCCGTCTTCTTCGTTCTCGTCCAGACAACCTCCATCGCCGGTGAGGCTCGCACGATCCCGCCCAGCCTGAGT
CGCAACCGGGACGTTTGGCTCGCGGCAGGCTACGCCATGTGCACCACCGGCGGCGTCTACGTCCCGGTCCTCTAT
CTGCCCGTCTGGTTCCAGACGGTGCGCGGGCAGTCGGCTCTCGTGGCCGGCGCGATGCTCACGCCTCTCATCGCC
AGCTATGTCGCCTGCTCCGTCGTTGCCGGCGCTCTTACGACCATGACTGGCTACTACAATCCGGGCATGATCATC
GGCACTGCGCTGGCCATTGCCGGGGCAGCGGTCTTGACTACGCTCAACATTGACGCCTCGACAGCCCGTGCCGTC
GGCTATCAGCTGCTCTATGGCTTCGGCATCGGCTTCGCATTCGGCCAGCCCAGCTATGTGGTCCAGACCTTGCTC
CCCGAGGCTGACGTCCCGGTGGGCGTCACATTCATCACCTTGGTCCAGAACCTCAGCGCATCTGTCTTTGTAGCT
GTGGCCCAGAGCATCTTTCAAGGGGGCCTTCGCTCGCGTCTTCGCCAGGAGTTGCCGGGCGTGGACCTCTCTCCC
ATCCTCGACTCCGGCTTATCGAATTTCAGGTCATCACTGCCCCAAGACAAGCAGCTTGCTGGCCTTCGAGCATTC
AGCGCATCCCTCGTGACCACGTTCTATATCTCGCTGGCGCTTAGTGCCGTATCTGCCGTCGGGGCCTTGGGAATA
AGATGGGTCTCCATGAAGCCGGGCTACAGTCAAGCACCGGCCGAGACAAGTCAGACATGTCAGCAAGAAGAGGAG
GCGGGGACGAAGGAGAGAGACACCAATCAGCAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail