Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3847
Gene name
LocationContig_203:7339..8023
Strand-
Gene length (bp)684
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 1.4E-09 129 212

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5T1C6|THEM4_HUMAN Acyl-coenzyme A thioesterase THEM4 OS=Homo sapiens GN=THEM4 PE=1 SV=1 113 225 2.0E-10
sp|A1A4L1|THEM4_BOVIN Acyl-coenzyme A thioesterase THEM4 OS=Bos taurus GN=THEM4 PE=2 SV=1 113 226 4.0E-08
sp|Q3UUI3|THEM4_MOUSE Acyl-coenzyme A thioesterase THEM4 OS=Mus musculus GN=Them4 PE=1 SV=1 113 226 1.0E-07
sp|Q566R0|THEM4_RAT Acyl-coenzyme A thioesterase THEM4 OS=Rattus norvegicus GN=Them4 PE=2 SV=1 113 225 3.0E-07
sp|Q6GLK2|THEM4_XENLA Acyl-coenzyme A thioesterase THEM4 OS=Xenopus laevis GN=them4 PE=2 SV=2 113 225 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3847
MPDEAAAAAAPFRVLCPALGLVPAQTPPGLYEAAVRHFAAVPWCAALLSPAADGAEPAIAFVPQCFNPAPGGGED
QFVGATLARAPGALLQMLCLFRPDDAAHVRDPARPIGRVSTLYALGDGLSGYRGILHGGVVATLMDETLGIVHEL
NAVLGKAGAAPAGATNVTARLAVSFRRPVPVPGHVRVTAWVCAVDGRKTRMACEVAGPDGTVMAEAESVWVMVGP
KM*
Coding >Hirsu2|3847
ATGCCGGACGAGGCCGCCGCCGCCGCGGCGCCGTTCCGGGTGCTCTGCCCGGCGCTCGGGCTGGTGCCGGCGCAG
ACGCCGCCGGGGCTGTACGAGGCGGCGGTGCGGCACTTCGCGGCGGTGCCGTGGTGCGCGGCGCTGCTGTCGCCG
GCGGCGGACGGGGCGGAGCCGGCCATCGCCTTCGTGCCGCAGTGCTTCAACCCGGCGCCCGGCGGGGGCGAGGAC
CAGTTCGTGGGCGCGACGCTGGCCCGGGCGCCGGGCGCGCTGCTGCAGATGCTGTGCCTGTTCCGGCCCGACGAC
GCGGCCCACGTGCGCGACCCGGCGCGGCCCATCGGCCGCGTCTCGACCCTGTACGCCCTCGGCGACGGCCTGTCG
GGCTACCGCGGCATCCTGCACGGCGGCGTCGTCGCGACCCTGATGGACGAGACGCTCGGCATCGTGCACGAGCTC
AACGCCGTCCTCGGCAAGGCCGGCGCCGCCCCGGCCGGCGCCACCAACGTCACCGCCCGCCTGGCCGTCTCCTTC
CGCCGCCCCGTGCCGGTGCCGGGCCACGTCCGCGTCACGGCCTGGGTCTGCGCCGTCGACGGCCGCAAGACCCGC
ATGGCCTGCGAGGTCGCCGGCCCGGACGGCACCGTCATGGCCGAGGCCGAGAGCGTCTGGGTCATGGTCGGGCCC
AAGATGTAG
Transcript >Hirsu2|3847
ATGCCGGACGAGGCCGCCGCCGCCGCGGCGCCGTTCCGGGTGCTCTGCCCGGCGCTCGGGCTGGTGCCGGCGCAG
ACGCCGCCGGGGCTGTACGAGGCGGCGGTGCGGCACTTCGCGGCGGTGCCGTGGTGCGCGGCGCTGCTGTCGCCG
GCGGCGGACGGGGCGGAGCCGGCCATCGCCTTCGTGCCGCAGTGCTTCAACCCGGCGCCCGGCGGGGGCGAGGAC
CAGTTCGTGGGCGCGACGCTGGCCCGGGCGCCGGGCGCGCTGCTGCAGATGCTGTGCCTGTTCCGGCCCGACGAC
GCGGCCCACGTGCGCGACCCGGCGCGGCCCATCGGCCGCGTCTCGACCCTGTACGCCCTCGGCGACGGCCTGTCG
GGCTACCGCGGCATCCTGCACGGCGGCGTCGTCGCGACCCTGATGGACGAGACGCTCGGCATCGTGCACGAGCTC
AACGCCGTCCTCGGCAAGGCCGGCGCCGCCCCGGCCGGCGCCACCAACGTCACCGCCCGCCTGGCCGTCTCCTTC
CGCCGCCCCGTGCCGGTGCCGGGCCACGTCCGCGTCACGGCCTGGGTCTGCGCCGTCGACGGCCGCAAGACCCGC
ATGGCCTGCGAGGTCGCCGGCCCGGACGGCACCGTCATGGCCGAGGCCGAGAGCGTCTGGGTCATGGTCGGGCCC
AAGATGTAG
Gene >Hirsu2|3847
ATGCCGGACGAGGCCGCCGCCGCCGCGGCGCCGTTCCGGGTGCTCTGCCCGGCGCTCGGGCTGGTGCCGGCGCAG
ACGCCGCCGGGGCTGTACGAGGCGGCGGTGCGGCACTTCGCGGCGGTGCCGTGGTGCGCGGCGCTGCTGTCGCCG
GCGGCGGACGGGGCGGAGCCGGCCATCGCCTTCGTGCCGCAGTGCTTCAACCCGGCGCCCGGCGGGGGCGAGGAC
CAGTTCGTGGGCGCGACGCTGGCCCGGGCGCCGGGCGCGCTGCTGCAGATGCTGTGCCTGTTCCGGCCCGACGAC
GCGGCCCACGTGCGCGACCCGGCGCGGCCCATCGGCCGCGTCTCGACCCTGTACGCCCTCGGCGACGGCCTGTCG
GGCTACCGCGGCATCCTGCACGGCGGCGTCGTCGCGACCCTGATGGACGAGACGCTCGGCATCGTGCACGAGCTC
AACGCCGTCCTCGGCAAGGCCGGCGCCGCCCCGGCCGGCGCCACCAACGTCACCGCCCGCCTGGCCGTCTCCTTC
CGCCGCCCCGTGCCGGTGCCGGGCCACGTCCGCGTCACGGCCTGGGTCTGCGCCGTCGACGGCCGCAAGACCCGC
ATGGCCTGCGAGGTCGCCGGCCCGGACGGCACCGTCATGGCCGAGGCCGAGAGCGTCTGGGTCATGGTCGGGCCC
AAGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail