Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3844
Gene name
LocationContig_2029:409..2603
Strand+
Gene length (bp)2194
Transcript length (bp)2118
Coding sequence length (bp)2118
Protein length (aa) 706

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.7E-03 140 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 122 188 4.0E-23
sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 132 190 8.0E-20
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 114 189 1.0E-19
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 107 187 8.0E-12
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 140 256 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 122 188 4.0E-23
sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 132 190 8.0E-20
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 114 189 1.0E-19
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 107 187 8.0E-12
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 140 256 1.0E-10
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 122 183 2.0E-09
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 127 187 6.0E-09
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 140 230 8.0E-09
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 140 240 8.0E-09
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 131 188 1.0E-08
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 130 192 1.0E-08
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 130 192 2.0E-08
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 132 183 2.0E-08
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 140 230 2.0E-08
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 123 183 2.0E-08
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 125 183 2.0E-08
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 132 183 2.0E-08
sp|Q0IH98|ZB8AA_XENLA Zinc finger and BTB domain-containing protein 8A.1-A OS=Xenopus laevis GN=zbtb8a.1-a PE=2 SV=1 129 185 2.0E-08
sp|A1L2U9|ZB8AB_XENLA Zinc finger and BTB domain-containing protein 8A.1-B OS=Xenopus laevis GN=zbtb8a.1-b PE=2 SV=1 129 185 2.0E-08
sp|B1WAZ8|ZBT8A_XENTR Zinc finger and BTB domain-containing protein 8A OS=Xenopus tropicalis GN=zbtb8a PE=2 SV=1 129 185 2.0E-08
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 133 182 3.0E-08
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 133 182 4.0E-08
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 119 183 4.0E-08
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 132 190 5.0E-08
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 119 183 5.0E-08
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 133 182 5.0E-08
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 140 222 5.0E-08
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 138 185 5.0E-08
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 125 183 5.0E-08
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 125 183 6.0E-08
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 132 183 6.0E-08
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 140 185 6.0E-08
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 140 227 6.0E-08
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 140 188 6.0E-08
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 119 183 7.0E-08
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 132 183 7.0E-08
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 125 183 7.0E-08
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 125 183 7.0E-08
sp|Q9P7D9|RSV1_SCHPO Zinc finger protein rsv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv1 PE=2 SV=1 136 183 7.0E-08
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 132 188 7.0E-08
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 140 188 8.0E-08
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 140 188 8.0E-08
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 140 188 9.0E-08
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 140 188 9.0E-08
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 111 180 9.0E-08
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 132 180 1.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 132 180 1.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 132 180 1.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 132 180 1.0E-07
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 111 180 1.0E-07
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 140 188 1.0E-07
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 125 188 1.0E-07
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 133 182 1.0E-07
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 125 188 1.0E-07
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 125 183 1.0E-07
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 132 199 1.0E-07
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 132 199 1.0E-07
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 132 199 1.0E-07
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 133 183 1.0E-07
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 132 199 1.0E-07
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 133 183 1.0E-07
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 132 199 1.0E-07
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 133 182 1.0E-07
sp|O73694|EGR1_SERCA Early growth response protein 1 (Fragment) OS=Serinus canaria GN=EGR1 PE=3 SV=1 140 183 1.0E-07
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 132 183 1.0E-07
sp|O94131|CREA_GIBFU DNA-binding protein creA OS=Gibberella fujikuroi GN=CREA PE=3 SV=1 83 187 1.0E-07
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 120 183 2.0E-07
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 120 183 2.0E-07
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 140 225 2.0E-07
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 132 180 2.0E-07
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 132 180 2.0E-07
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 132 180 2.0E-07
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 132 180 2.0E-07
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 117 188 2.0E-07
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 134 227 2.0E-07
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 130 182 2.0E-07
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 140 210 2.0E-07
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 130 182 2.0E-07
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 140 188 2.0E-07
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 138 189 2.0E-07
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 132 187 2.0E-07
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 132 185 2.0E-07
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 130 182 2.0E-07
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 130 182 2.0E-07
sp|B1WBU4|ZBT8A_RAT Zinc finger and BTB domain-containing protein 8A OS=Rattus norvegicus GN=Zbtb8a PE=2 SV=1 131 185 2.0E-07
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 132 187 2.0E-07
sp|Q0VCJ6|ZBT8A_BOVIN Zinc finger and BTB domain-containing protein 8A OS=Bos taurus GN=ZBTB8A PE=2 SV=1 131 185 2.0E-07
sp|Q9CWH1|ZBT8A_MOUSE Zinc finger and BTB domain-containing protein 8A OS=Mus musculus GN=Zbtb8a PE=2 SV=1 131 185 2.0E-07
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 140 244 3.0E-07
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 132 180 3.0E-07
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 140 188 3.0E-07
sp|Q96BR9|ZBT8A_HUMAN Zinc finger and BTB domain-containing protein 8A OS=Homo sapiens GN=ZBTB8A PE=1 SV=2 131 185 3.0E-07
sp|Q8SUR9|Z856_ENCCU Zinc finger C2H2 protein ECU08_0560 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0560 PE=3 SV=2 132 183 3.0E-07
sp|P26635|EGR2_POERE Early growth response protein 2 (Fragment) OS=Poecilia reticulata GN=egr2 PE=3 SV=1 140 183 3.0E-07
sp|P52288|MIG1_KLUMA Regulatory protein MIG1 OS=Kluyveromyces marxianus GN=MIG1 PE=3 SV=1 116 180 3.0E-07
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 126 183 3.0E-07
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 117 188 3.0E-07
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 117 188 3.0E-07
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 140 188 3.0E-07
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 120 228 3.0E-07
sp|Q8VHT8|TF3A_RAT Transcription factor IIIA OS=Rattus norvegicus GN=Gtf3a PE=2 SV=2 132 212 3.0E-07
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 140 210 3.0E-07
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 140 188 3.0E-07
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 122 187 3.0E-07
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 138 188 3.0E-07
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 127 180 3.0E-07
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 125 189 3.0E-07
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 120 183 4.0E-07
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 140 244 4.0E-07
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 140 188 4.0E-07
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 130 188 4.0E-07
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 140 188 4.0E-07
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 140 188 4.0E-07
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 140 188 4.0E-07
sp|P26633|EGR2_CRIGR E3 SUMO-protein ligase EGR2 (Fragment) OS=Cricetulus griseus GN=EGR2 PE=2 SV=1 140 183 4.0E-07
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 140 188 4.0E-07
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 140 188 4.0E-07
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 116 182 4.0E-07
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 140 188 5.0E-07
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 140 188 5.0E-07
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 140 188 5.0E-07
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 133 182 5.0E-07
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 140 188 5.0E-07
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 140 188 5.0E-07
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 126 252 6.0E-07
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 140 237 6.0E-07
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 140 188 6.0E-07
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 132 200 6.0E-07
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 138 187 6.0E-07
sp|Q5A0E5|NRG1_CANAL Transcriptional regulator NRG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NRG1 PE=2 SV=1 140 187 6.0E-07
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 140 188 6.0E-07
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 133 182 6.0E-07
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 133 182 7.0E-07
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 132 182 7.0E-07
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 126 210 7.0E-07
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 132 182 7.0E-07
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 130 188 8.0E-07
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 132 182 8.0E-07
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 130 185 8.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 132 211 8.0E-07
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 132 180 8.0E-07
sp|O94166|CREA_ASPAC DNA-binding protein creA OS=Aspergillus aculeatus GN=creA PE=3 SV=1 138 187 9.0E-07
sp|C7EMF5|KLF17_PIG Krueppel-like factor 17 OS=Sus scrofa GN=KLF17 PE=2 SV=1 125 183 9.0E-07
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 138 188 9.0E-07
sp|B0XSK6|CREA_ASPFC Probable DNA-binding protein creA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creA PE=3 SV=1 138 187 9.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 124 204 1.0E-06
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 124 204 1.0E-06
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 140 188 1.0E-06
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 138 182 1.0E-06
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 132 182 1.0E-06
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 138 188 1.0E-06
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 131 188 1.0E-06
sp|Q9P889|CREA_ASPOR DNA-binding protein creA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creA PE=3 SV=1 138 187 1.0E-06
sp|B8NGC8|CREA_ASPFN Probable DNA-binding protein creA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creA PE=3 SV=1 138 187 1.0E-06
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 138 187 1.0E-06
sp|A2QCJ9|CREA_ASPNC Probable DNA-binding protein creA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creA PE=3 SV=1 138 187 1.0E-06
sp|Q05620|CREA_ASPNG DNA-binding protein creA OS=Aspergillus niger GN=creA PE=3 SV=1 138 187 1.0E-06
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 138 188 1.0E-06
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 138 187 1.0E-06
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 133 182 1.0E-06
sp|A1DH89|CREA_NEOFI Probable DNA-binding protein creA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creA PE=3 SV=1 138 187 1.0E-06
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 120 192 1.0E-06
sp|Q92664|TF3A_HUMAN Transcription factor IIIA OS=Homo sapiens GN=GTF3A PE=1 SV=3 132 188 1.0E-06
sp|Q8BLM0|KLF8_MOUSE Krueppel-like factor 8 OS=Mus musculus GN=Klf8 PE=2 SV=1 132 180 1.0E-06
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 131 188 1.0E-06
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 140 185 1.0E-06
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 123 188 1.0E-06
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 103 182 1.0E-06
sp|A1C6L9|CREA_ASPCL Probable DNA-binding protein creA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creA PE=3 SV=1 138 187 1.0E-06
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 130 183 1.0E-06
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 123 188 1.0E-06
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 140 185 1.0E-06
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 132 182 2.0E-06
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 132 191 2.0E-06
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 121 180 2.0E-06
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 138 204 2.0E-06
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 123 188 2.0E-06
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 128 185 2.0E-06
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 138 204 2.0E-06
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 138 187 2.0E-06
sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=KLF7 PE=2 SV=1 133 182 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 132 211 2.0E-06
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 132 188 2.0E-06
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 126 242 2.0E-06
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 132 187 2.0E-06
sp|P10069|BRLA_EMENI Regulatory protein brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=brlA PE=3 SV=1 128 185 2.0E-06
sp|Q99JB0|KLF7_MOUSE Krueppel-like factor 7 OS=Mus musculus GN=Klf7 PE=2 SV=1 133 182 2.0E-06
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 134 180 2.0E-06
sp|Q8VHT7|TF3A_MOUSE Transcription factor IIIA OS=Mus musculus GN=Gtf3a PE=2 SV=2 132 208 2.0E-06
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 134 180 2.0E-06
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 133 182 2.0E-06
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 138 188 2.0E-06
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 134 188 2.0E-06
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 127 180 3.0E-06
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 127 180 3.0E-06
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 132 191 3.0E-06
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 123 188 3.0E-06
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 138 187 3.0E-06
sp|O35738|KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus GN=Klf12 PE=1 SV=2 111 180 3.0E-06
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 123 188 3.0E-06
sp|P50898|MIG1_KLULA Regulatory protein MIG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIG1 PE=3 SV=1 132 180 3.0E-06
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 123 188 3.0E-06
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 123 188 3.0E-06
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 126 210 3.0E-06
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 111 180 3.0E-06
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 120 180 4.0E-06
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 137 188 4.0E-06
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 122 180 4.0E-06
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 132 183 4.0E-06
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 132 183 4.0E-06
sp|B7ZRU9|EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis GN=mecom-a PE=1 SV=1 126 226 4.0E-06
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 140 188 4.0E-06
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 138 188 4.0E-06
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 120 180 5.0E-06
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 137 188 5.0E-06
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 137 188 5.0E-06
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 132 188 5.0E-06
sp|P26634|EGR2_CERTH E3 SUMO-protein ligase EGR2 (Fragment) OS=Cerdocyon thous GN=EGR2 PE=3 SV=1 140 183 5.0E-06
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 136 192 6.0E-06
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 131 183 6.0E-06
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 129 188 7.0E-06
sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster GN=ham PE=2 SV=1 120 221 7.0E-06
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 133 183 7.0E-06
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 133 185 8.0E-06
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 140 233 8.0E-06
sp|C7EMF5|KLF17_PIG Krueppel-like factor 17 OS=Sus scrofa GN=KLF17 PE=2 SV=1 123 213 9.0E-06
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 140 233 9.0E-06
sp|O95863|SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens GN=SNAI1 PE=1 SV=2 140 215 9.0E-06
sp|P25932|ESCA_DROME Protein escargot OS=Drosophila melanogaster GN=esg PE=1 SV=2 140 205 1.0E-05
sp|B7ZRM8|EVI1B_XENLA MDS1 and EVI1 complex locus protein EVI1-B OS=Xenopus laevis GN=mecom-b PE=2 SV=1 126 188 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3844
MAAAFRPVNSSLIPPTISEDASRPTTAPHPPAMSVHDATTPTRATFAAAGQKPLPTTPFAQAVQAPDAHADRQPR
DHSQHSAKSSSRRDSADVDMDDSDADVANPDADAASDDDSVNADGSKSGKKKKSQRFYCTDYPPCNLSFTRSEHL
ARHIRKHTGERPFQCHCSRRFSRLDNLRQHAQTVHVNEDIPIDSLAATGSRFQRQIRTDRVRQAGNRARASTGGS
AGGPARGHSKSLSTSSITSMSSVASSSYGAPGPDARRRPPPLVMAADPRSRLSLESYRSGADSPYSAYRPPSPAD
FSTPTSATFSTAQSSPRWASPTSSHSRSQSLYAAGSRTPGRRLSVPSGANPFQPGPQHQHQHQHQHQHQHHHHQQ
SSRPAFGPPGLLNSSHPAALPSSGASSAVTSPASSTSGWSGRRESSWGAADEAWRRRTWHPDSRPYNGQAPPPPP
PPHQLSAVGSQSVRPNPPPPIANPAGPPSSSFRLPGIESSDPVPRRHPSPMAVDPEPPARRAPAYPPGEPMQPDE
RRNLNMYDASLQRGLTRLDISHKTPPRDSAGAWASEANKAVQAQAERVRQNPPSVRFEDPLPPSHAHPGPPPTRP
LHQQTMSAPSVPSAAPPTAPKRHGWYHGPPAPHGVHGPPPPQQQDPRAAHVGRMVHPNLNGFNGFPVREPPPPPP
QERPANADPLRRLEALVAVATSEGSTATAY*
Coding >Hirsu2|3844
ATGGCCGCCGCCTTTCGCCCCGTCAACTCTAGCCTGATCCCCCCGACCATCTCCGAGGACGCGAGCCGGCCCACC
ACGGCCCCCCATCCGCCCGCCATGTCCGTCCACGACGCCACGACGCCGACGCGCGCCACCTTCGCCGCCGCCGGC
CAGAAGCCCCTGCCCACGACCCCCTTCGCCCAGGCCGTCCAGGCGCCCGACGCCCACGCCGACCGACAGCCCCGC
GACCACTCGCAGCACTCGGCCAAGTCGTCGTCCCGCCGCGACTCCGCCGACGTCGACATGGACGACTCCGACGCC
GACGTCGCCAACCCCGACGCCGACGCCGCCTCCGACGACGACAGCGTCAACGCCGACGGCTCCAAGTCGGGCAAG
AAGAAGAAGTCGCAGCGCTTCTACTGCACCGACTATCCCCCCTGCAACCTGAGCTTCACCCGCAGCGAGCACCTG
GCCCGCCACATCCGGAAACATACCGGCGAGCGGCCCTTCCAGTGCCATTGCTCCCGCCGCTTCTCCCGTCTCGAC
AACCTGAGGCAGCACGCGCAGACGGTCCACGTCAACGAGGACATCCCCATCGACTCCTTAGCCGCCACCGGCTCG
AGATTCCAGCGCCAGATCCGCACCGACCGCGTCCGCCAAGCCGGCAACAGGGCCCGCGCCTCGACCGGCGGCAGC
GCCGGCGGCCCCGCGCGCGGCCACTCCAAGTCCTTGTCGACCTCGAGCATCACCAGCATGAGCTCCGTCGCCTCG
TCGTCCTACGGCGCCCCGGGCCCCGACGCCCGTCGCCGCCCGCCGCCCCTCGTCATGGCCGCCGACCCCCGCTCC
CGCCTGTCCCTCGAGTCGTACCGCAGCGGCGCCGACAGCCCCTACTCGGCCTACCGGCCCCCGTCGCCCGCCGAC
TTCAGCACGCCCACCTCGGCCACCTTCTCGACGGCCCAGAGCAGCCCGCGCTGGGCTTCGCCCACCTCGTCCCAC
TCGCGCTCCCAGAGCCTCTACGCCGCCGGCAGCCGCACCCCGGGCCGCCGCCTCAGCGTCCCCTCGGGCGCCAAC
CCCTTCCAGCCCGGCCCCCAGCACCAGCACCAGCACCAGCACCAGCATCAACACCAACACCACCACCACCAGCAG
TCGTCCCGTCCGGCCTTCGGCCCGCCGGGCCTCCTCAACAGCTCGCACCCGGCCGCCCTCCCATCCTCGGGCGCC
AGCAGCGCCGTCACCTCACCGGCCTCGTCCACCTCGGGCTGGTCCGGCCGCCGCGAGTCGAGCTGGGGCGCGGCC
GACGAGGCGTGGCGGAGGCGCACCTGGCACCCTGACAGCCGCCCCTACAACGGCCAGGCCCCGCCGCCGCCGCCG
CCGCCCCACCAGCTGAGCGCCGTCGGCAGCCAGTCGGTGCGGCCGAACCCCCCGCCGCCCATCGCCAACCCGGCG
GGCCCGCCGTCGTCGTCGTTCCGCCTCCCCGGCATCGAGTCGTCCGACCCCGTCCCCCGCCGCCATCCGTCGCCC
ATGGCCGTCGACCCGGAGCCGCCGGCGCGGCGCGCCCCCGCCTACCCGCCGGGCGAGCCGATGCAGCCGGACGAG
CGCCGCAACCTCAACATGTACGACGCCAGCCTGCAGCGCGGCCTGACGCGCCTCGACATCAGCCACAAGACGCCG
CCCCGAGACAGCGCCGGTGCCTGGGCGTCGGAGGCCAACAAGGCCGTCCAGGCGCAGGCCGAGCGCGTGCGCCAG
AACCCGCCTAGTGTCCGCTTCGAGGATCCGCTGCCGCCTTCGCACGCGCACCCGGGCCCGCCGCCGACGCGACCG
CTGCACCAGCAGACCATGTCGGCGCCCTCGGTGCCGTCGGCCGCTCCCCCGACGGCGCCCAAGCGCCACGGTTGG
TATCACGGCCCGCCGGCCCCCCACGGCGTCCACGGGCCCCCGCCTCCGCAGCAGCAAGACCCGCGCGCGGCCCAC
GTCGGCCGCATGGTGCACCCGAACCTCAACGGCTTCAACGGCTTTCCCGTCCGGGAGCCGCCGCCGCCGCCGCCG
CAGGAGCGTCCGGCCAACGCCGACCCGCTGCGCCGTCTCGAGGCCCTGGTCGCCGTGGCCACGAGCGAGGGGTCG
ACGGCCACGGCGTACTGA
Transcript >Hirsu2|3844
ATGGCCGCCGCCTTTCGCCCCGTCAACTCTAGCCTGATCCCCCCGACCATCTCCGAGGACGCGAGCCGGCCCACC
ACGGCCCCCCATCCGCCCGCCATGTCCGTCCACGACGCCACGACGCCGACGCGCGCCACCTTCGCCGCCGCCGGC
CAGAAGCCCCTGCCCACGACCCCCTTCGCCCAGGCCGTCCAGGCGCCCGACGCCCACGCCGACCGACAGCCCCGC
GACCACTCGCAGCACTCGGCCAAGTCGTCGTCCCGCCGCGACTCCGCCGACGTCGACATGGACGACTCCGACGCC
GACGTCGCCAACCCCGACGCCGACGCCGCCTCCGACGACGACAGCGTCAACGCCGACGGCTCCAAGTCGGGCAAG
AAGAAGAAGTCGCAGCGCTTCTACTGCACCGACTATCCCCCCTGCAACCTGAGCTTCACCCGCAGCGAGCACCTG
GCCCGCCACATCCGGAAACATACCGGCGAGCGGCCCTTCCAGTGCCATTGCTCCCGCCGCTTCTCCCGTCTCGAC
AACCTGAGGCAGCACGCGCAGACGGTCCACGTCAACGAGGACATCCCCATCGACTCCTTAGCCGCCACCGGCTCG
AGATTCCAGCGCCAGATCCGCACCGACCGCGTCCGCCAAGCCGGCAACAGGGCCCGCGCCTCGACCGGCGGCAGC
GCCGGCGGCCCCGCGCGCGGCCACTCCAAGTCCTTGTCGACCTCGAGCATCACCAGCATGAGCTCCGTCGCCTCG
TCGTCCTACGGCGCCCCGGGCCCCGACGCCCGTCGCCGCCCGCCGCCCCTCGTCATGGCCGCCGACCCCCGCTCC
CGCCTGTCCCTCGAGTCGTACCGCAGCGGCGCCGACAGCCCCTACTCGGCCTACCGGCCCCCGTCGCCCGCCGAC
TTCAGCACGCCCACCTCGGCCACCTTCTCGACGGCCCAGAGCAGCCCGCGCTGGGCTTCGCCCACCTCGTCCCAC
TCGCGCTCCCAGAGCCTCTACGCCGCCGGCAGCCGCACCCCGGGCCGCCGCCTCAGCGTCCCCTCGGGCGCCAAC
CCCTTCCAGCCCGGCCCCCAGCACCAGCACCAGCACCAGCACCAGCATCAACACCAACACCACCACCACCAGCAG
TCGTCCCGTCCGGCCTTCGGCCCGCCGGGCCTCCTCAACAGCTCGCACCCGGCCGCCCTCCCATCCTCGGGCGCC
AGCAGCGCCGTCACCTCACCGGCCTCGTCCACCTCGGGCTGGTCCGGCCGCCGCGAGTCGAGCTGGGGCGCGGCC
GACGAGGCGTGGCGGAGGCGCACCTGGCACCCTGACAGCCGCCCCTACAACGGCCAGGCCCCGCCGCCGCCGCCG
CCGCCCCACCAGCTGAGCGCCGTCGGCAGCCAGTCGGTGCGGCCGAACCCCCCGCCGCCCATCGCCAACCCGGCG
GGCCCGCCGTCGTCGTCGTTCCGCCTCCCCGGCATCGAGTCGTCCGACCCCGTCCCCCGCCGCCATCCGTCGCCC
ATGGCCGTCGACCCGGAGCCGCCGGCGCGGCGCGCCCCCGCCTACCCGCCGGGCGAGCCGATGCAGCCGGACGAG
CGCCGCAACCTCAACATGTACGACGCCAGCCTGCAGCGCGGCCTGACGCGCCTCGACATCAGCCACAAGACGCCG
CCCCGAGACAGCGCCGGTGCCTGGGCGTCGGAGGCCAACAAGGCCGTCCAGGCGCAGGCCGAGCGCGTGCGCCAG
AACCCGCCTAGTGTCCGCTTCGAGGATCCGCTGCCGCCTTCGCACGCGCACCCGGGCCCGCCGCCGACGCGACCG
CTGCACCAGCAGACCATGTCGGCGCCCTCGGTGCCGTCGGCCGCTCCCCCGACGGCGCCCAAGCGCCACGGTTGG
TATCACGGCCCGCCGGCCCCCCACGGCGTCCACGGGCCCCCGCCTCCGCAGCAGCAAGACCCGCGCGCGGCCCAC
GTCGGCCGCATGGTGCACCCGAACCTCAACGGCTTCAACGGCTTTCCCGTCCGGGAGCCGCCGCCGCCGCCGCCG
CAGGAGCGTCCGGCCAACGCCGACCCGCTGCGCCGTCTCGAGGCCCTGGTCGCCGTGGCCACGAGCGAGGGGTCG
ACGGCCACGGCGTACTGA
Gene >Hirsu2|3844
ATGGCCGCCGCCTTTCGCCCCGTCAACTCTAGCCTGATCCCCCCGACCATCTCCGAGGACGCGAGCCGGCCCACC
ACGGCCCCCCATCCGCCCGCCATGTCCGTCCACGACGCCACGACGCCGACGCGCGCCACCTTCGCCGCCGCCGGC
CAGAAGCCCCTGCCCACGACCCCCTTCGCCCAGGCCGTCCAGGCGCCCGACGCCCACGCCGACCGACAGCCCCGC
GACCACTCGCAGCACTCGGCCAAGTCGTCGTCCCGCCGCGACTCCGCCGACGTCGACATGGACGACTCCGACGCC
GACGTCGCCAACCCCGACGCCGACGCCGCCTCCGACGACGACAGCGTCAACGCCGACGGCTCCAAGTCGGGCAAG
AAGAAGAAGTCGCAGCGCTTCTACTGCACCGACTATCCCCCCTGCAACCTGAGCTTCACCCGCAGCGAGCACCTG
GCCCGCCACATCCGGTGAGGCCCCTCTCCCCCTCGGTCTTTTCCTCCCCCGCGGCGCTGGCTGACGACGACGGCG
AAAACCGTCCCACAGGAAACATACCGGCGAGCGGCCCTTCCAGTGCCATTGCTCCCGCCGCTTCTCCCGTCTCGA
CAACCTGAGGCAGCACGCGCAGACGGTCCACGTCAACGAGGACATCCCCATCGACTCCTTAGCCGCCACCGGCTC
GAGATTCCAGCGCCAGATCCGCACCGACCGCGTCCGCCAAGCCGGCAACAGGGCCCGCGCCTCGACCGGCGGCAG
CGCCGGCGGCCCCGCGCGCGGCCACTCCAAGTCCTTGTCGACCTCGAGCATCACCAGCATGAGCTCCGTCGCCTC
GTCGTCCTACGGCGCCCCGGGCCCCGACGCCCGTCGCCGCCCGCCGCCCCTCGTCATGGCCGCCGACCCCCGCTC
CCGCCTGTCCCTCGAGTCGTACCGCAGCGGCGCCGACAGCCCCTACTCGGCCTACCGGCCCCCGTCGCCCGCCGA
CTTCAGCACGCCCACCTCGGCCACCTTCTCGACGGCCCAGAGCAGCCCGCGCTGGGCTTCGCCCACCTCGTCCCA
CTCGCGCTCCCAGAGCCTCTACGCCGCCGGCAGCCGCACCCCGGGCCGCCGCCTCAGCGTCCCCTCGGGCGCCAA
CCCCTTCCAGCCCGGCCCCCAGCACCAGCACCAGCACCAGCACCAGCATCAACACCAACACCACCACCACCAGCA
GTCGTCCCGTCCGGCCTTCGGCCCGCCGGGCCTCCTCAACAGCTCGCACCCGGCCGCCCTCCCATCCTCGGGCGC
CAGCAGCGCCGTCACCTCACCGGCCTCGTCCACCTCGGGCTGGTCCGGCCGCCGCGAGTCGAGCTGGGGCGCGGC
CGACGAGGCGTGGCGGAGGCGCACCTGGCACCCTGACAGCCGCCCCTACAACGGCCAGGCCCCGCCGCCGCCGCC
GCCGCCCCACCAGCTGAGCGCCGTCGGCAGCCAGTCGGTGCGGCCGAACCCCCCGCCGCCCATCGCCAACCCGGC
GGGCCCGCCGTCGTCGTCGTTCCGCCTCCCCGGCATCGAGTCGTCCGACCCCGTCCCCCGCCGCCATCCGTCGCC
CATGGCCGTCGACCCGGAGCCGCCGGCGCGGCGCGCCCCCGCCTACCCGCCGGGCGAGCCGATGCAGCCGGACGA
GCGCCGCAACCTCAACATGTACGACGCCAGCCTGCAGCGCGGCCTGACGCGCCTCGACATCAGCCACAAGACGCC
GCCCCGAGACAGCGCCGGTGCCTGGGCGTCGGAGGCCAACAAGGCCGTCCAGGCGCAGGCCGAGCGCGTGCGCCA
GAACCCGCCTAGTGTCCGCTTCGAGGATCCGCTGCCGCCTTCGCACGCGCACCCGGGCCCGCCGCCGACGCGACC
GCTGCACCAGCAGACCATGTCGGCGCCCTCGGTGCCGTCGGCCGCTCCCCCGACGGCGCCCAAGCGCCACGGTTG
GTATCACGGCCCGCCGGCCCCCCACGGCGTCCACGGGCCCCCGCCTCCGCAGCAGCAAGACCCGCGCGCGGCCCA
CGTCGGCCGCATGGTGCACCCGAACCTCAACGGCTTCAACGGCTTTCCCGTCCGGGAGCCGCCGCCGCCGCCGCC
GCAGGAGCGTCCGGCCAACGCCGACCCGCTGCGCCGTCTCGAGGCCCTGGTCGCCGTGGCCACGAGCGAGGGGTC
GACGGCCACGGCGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail