Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3841
Gene name
LocationContig_2026:2658..3652
Strand+
Gene length (bp)994
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 8 262 4.0E-51
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 2 262 1.0E-47
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 31 260 5.0E-38
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 49 188 4.0E-16
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 24 187 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 8 262 4.0E-51
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 2 262 1.0E-47
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 31 260 5.0E-38
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 49 188 4.0E-16
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 24 187 1.0E-14
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 205 260 1.0E-09
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 149 260 3.0E-07
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 198 263 6.0E-07
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 72 189 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3841
MMMLHPSVAVGAAFVVLAAAQPASAAAVHRQDSSGATLPHAQGPAAAKCTRWHDVLTAINCGDLLNVNELTMDEF
MQMNPSVGPECEGVAVGKSYCVDDGTVTRSTATPASAPSKTKRSDNGINTPRPIQPDMVPNCDAFYLVKRGERCV
DVAAVNRISVEHLTTWNRAAGPDCTGLWGDTWACVSVVGHEPPAQGFPSPVQRGIAMNCNRFRLVQQGQTCIDVA
AADNVSLDNFLAWNPAAGGRECGSLWAHYYACTGVSGG*
Coding >Hirsu2|3841
ATGATGATGCTTCACCCCTCCGTCGCCGTGGGCGCCGCATTCGTCGTCCTCGCCGCCGCCCAGCCGGCCTCGGCC
GCCGCCGTGCACCGCCAGGACTCCTCGGGGGCGACGCTGCCGCACGCCCAAGGCCCCGCCGCGGCCAAGTGCACC
CGGTGGCACGACGTCCTCACGGCCATCAACTGCGGCGACCTGCTCAACGTCAACGAGCTGACCATGGACGAGTTC
ATGCAGATGAACCCGTCCGTCGGGCCCGAGTGTGAGGGCGTCGCCGTCGGCAAATCGTACTGCGTCGACGACGGC
ACCGTCACGCGGTCCACGGCCACGCCGGCCTCGGCGCCGTCCAAGACGAAGCGCTCCGACAACGGCATCAACACG
CCCCGGCCGATCCAGCCCGACATGGTGCCCAACTGCGACGCCTTCTACCTCGTCAAGAGGGGCGAGCGCTGCGTC
GACGTGGCGGCCGTCAACAGGATCTCGGTCGAGCACCTGACGACGTGGAACCGCGCCGCGGGCCCCGACTGCACC
GGCCTCTGGGGCGACACGTGGGCCTGCGTCTCCGTCGTCGGCCACGAGCCCCCGGCCCAGGGCTTCCCGTCGCCG
GTCCAGCGCGGCATCGCCATGAACTGCAACCGCTTCCGCCTCGTCCAGCAGGGCCAGACCTGCATCGACGTCGCC
GCCGCCGACAACGTGTCCCTCGACAACTTCCTCGCCTGGAACCCGGCCGCCGGCGGCCGCGAGTGCGGCTCTCTG
TGGGCGCACTACTACGCCTGCACCGGCGTCAGCGGGGGATAG
Transcript >Hirsu2|3841
ATGATGATGCTTCACCCCTCCGTCGCCGTGGGCGCCGCATTCGTCGTCCTCGCCGCCGCCCAGCCGGCCTCGGCC
GCCGCCGTGCACCGCCAGGACTCCTCGGGGGCGACGCTGCCGCACGCCCAAGGCCCCGCCGCGGCCAAGTGCACC
CGGTGGCACGACGTCCTCACGGCCATCAACTGCGGCGACCTGCTCAACGTCAACGAGCTGACCATGGACGAGTTC
ATGCAGATGAACCCGTCCGTCGGGCCCGAGTGTGAGGGCGTCGCCGTCGGCAAATCGTACTGCGTCGACGACGGC
ACCGTCACGCGGTCCACGGCCACGCCGGCCTCGGCGCCGTCCAAGACGAAGCGCTCCGACAACGGCATCAACACG
CCCCGGCCGATCCAGCCCGACATGGTGCCCAACTGCGACGCCTTCTACCTCGTCAAGAGGGGCGAGCGCTGCGTC
GACGTGGCGGCCGTCAACAGGATCTCGGTCGAGCACCTGACGACGTGGAACCGCGCCGCGGGCCCCGACTGCACC
GGCCTCTGGGGCGACACGTGGGCCTGCGTCTCCGTCGTCGGCCACGAGCCCCCGGCCCAGGGCTTCCCGTCGCCG
GTCCAGCGCGGCATCGCCATGAACTGCAACCGCTTCCGCCTCGTCCAGCAGGGCCAGACCTGCATCGACGTCGCC
GCCGCCGACAACGTGTCCCTCGACAACTTCCTCGCCTGGAACCCGGCCGCCGGCGGCCGCGAGTGCGGCTCTCTG
TGGGCGCACTACTACGCCTGCACCGGCGTCAGCGGGGGATAG
Gene >Hirsu2|3841
ATGATGATGCTTCACCCCTCCGTCGCCGTGGGCGCCGCATTCGTCGTCCTCGCCGCCGCCCAGCCGGCCTCGGCC
GCCGCCGTGCACCGCCAGGACTCCTCGGGGGCGACGCTGCCGCACGCCCAAGGCCCCGCCGCGGCCAAGTGCACC
CGGTGGCACGACGTCCTCACGGCCATCAACTGCGGCGACCTGCTCAACGTCAACGAGCTGACCATGGACGAGTTC
ATGCAGATGGTGCGTCGAGCGGCCTCGTCCCCTTGAGAGCAGGAACAGGCGAAAGAAAAGGGGGGGGCTCGGGGG
GTTCCCTGTGTCCGGGACAATGCTGATCGTCTCCGGCGTAGAACCCGTCCGTCGGGCCCGAGTGTGAGGGCGTCG
CCGTCGGCAAATCGTACTGCGTCGACGACGGCACCGTCACGCGGTCCACGGCCACGCCGGCCTCGGCGCCGTCCA
AGACGAAGCGCTCCGACAACGGTAAGCCAGCCAGCCGGCCAGCGGCCACAGACGCGTCCACGCGCGCGCGGGAGG
AGAGAGAGGAAGGGCAAGTCAAAGGGACTGACGAGGCGCAGGCATCAACACGCCCCGGCCGATCCAGCCCGACAT
GGTGCCCAACTGCGACGCCTTCTACCTCGTCAAGAGGGGCGAGCGCTGCGTCGACGTGGCGGCCGTCAACAGGAT
CTCGGTCGAGCACCTGACGACGTGGAACCGCGCCGCGGGCCCCGACTGCACCGGCCTCTGGGGCGACACGTGGGC
CTGCGTCTCCGTCGTCGGCCACGAGCCCCCGGCCCAGGGCTTCCCGTCGCCGGTCCAGCGCGGCATCGCCATGAA
CTGCAACCGCTTCCGCCTCGTCCAGCAGGGCCAGACCTGCATCGACGTCGCCGCCGCCGACAACGTGTCCCTCGA
CAACTTCCTCGCCTGGAACCCGGCCGCCGGCGGCCGCGAGTGCGGCTCTCTGTGGGCGCACTACTACGCCTGCAC
CGGCGTCAGCGGGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail