Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3837
Gene name
LocationContig_2023:53..2867
Strand+
Gene length (bp)2814
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.3E-48 420 642

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 219 241 22
2 614 636 22
3 649 671 22
4 691 713 22
5 741 763 22
6 773 795 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3837
MVSYLHRRAIASGWIPPDSARNHDDCLGVLLRRSRGSYVTAPDPVHAVLLDACLRLNLAVAVTLRPQMLDGILRS
LAPGQAELRFKGGSQIQVVESLASVNSSNIKKFQYALVSRQEHLVLAWHDDLERIIPMATQVEEKLLSLVWGEGK
LPFNIGLPSGAPSIMSSGMSSPNGTMTPALEKAGAKIQISESTEELEEDSGFERPESVERPVARASAVFIGLAMC
LTLCLLLGVYCGQLVTEFYSGQKPSLRRAYADGFVPPKITIQMPVYKEGMESVIIPTVKSLQAAISFYELRGGSA
NLMICDDGLRAGLSAEEVSKRRAFYHDNDIGWVARPKHNGDEGFVRKGKFKKASNMNFALNASQKVEAYLQEMVD
AKVASGQSDLVDEADEADMYKSALARVLEENPLVWAEGDIRIGEIILLVDSDTRVPVDCLLYAAAELFLSPEVGI
IQHATGVMQVSHDYFENAITYFTNLVYTAISFSISSGESAPFVGHNAFLRWGAIQDVCPEEVEYTPYWSESHVSE
DFDIALRLQMKNFIIRVASYHGNGFKEGVSLTVYDEIMRWQKYSYGVSEMIFHPLHRWLFRGPFTPLFYTFLGSD
IMYSSKISILAYMCSYYALGAALPLSVMNYFIVGWFRDELASVYLTSWNVFLSLVVVFNLASPVALAVYRYRTGE
RSLLGALFENFKWMPAMTTFFGGISFHIGAALLAHLFHVDMQWGATSKEKEDSNFFQEIPRIFRTFKIMYLVLFL
IAGAMIYLGIFAPPDWAITDFSVIIPLSLNLGFHALVPLVLNPSLMIFHY*
Coding >Hirsu2|3837
ATGGTGAGCTACCTTCACCGGAGGGCCATCGCCAGCGGCTGGATACCCCCGGACTCGGCCCGGAACCACGACGAC
TGCCTGGGCGTCCTGCTGCGGCGCTCCCGCGGCAGCTACGTCACCGCCCCGGACCCTGTCCACGCCGTCCTCCTC
GATGCCTGCCTCCGGCTGAACCTGGCGGTTGCGGTTACCCTTCGGCCGCAGATGCTTGACGGGATCCTCCGCTCG
CTGGCACCGGGCCAGGCCGAACTCAGGTTCAAGGGTGGCTCGCAGATCCAGGTCGTCGAGTCGCTGGCCTCGGTC
AACTCGTCCAACATCAAGAAGTTCCAGTACGCCTTAGTCTCTCGTCAAGAGCACCTAGTCCTCGCGTGGCATGAT
GATTTGGAGCGTATTATTCCGATGGCCACGCAGGTCGAGGAGAAGCTGCTTTCGCTGGTCTGGGGAGAGGGCAAG
CTGCCGTTCAACATCGGCCTGCCCAGCGGCGCTCCCTCCATCATGTCTTCCGGCATGTCCAGCCCCAACGGCACA
ATGACGCCGGCGCTGGAGAAGGCCGGTGCCAAGATCCAAATAAGCGAGAGCACAGAAGAGCTGGAAGAGGACTCG
GGCTTTGAGCGGCCCGAGTCGGTTGAAAGGCCCGTCGCCCGCGCGAGCGCCGTCTTCATCGGCCTCGCCATGTGC
TTAACGCTTTGCCTGTTGCTAGGTGTCTACTGCGGCCAGCTCGTAACTGAATTTTACAGTGGCCAAAAACCTTCG
CTGCGGCGCGCCTACGCAGACGGCTTCGTGCCGCCCAAGATCACCATCCAGATGCCCGTCTACAAGGAGGGCATG
GAGTCGGTCATCATCCCGACCGTCAAAAGTTTGCAAGCCGCCATCTCGTTCTACGAGCTCCGCGGCGGCTCTGCC
AATCTCATGATTTGTGACGACGGTTTGAGAGCCGGCCTCTCAGCTGAAGAGGTTTCGAAGCGACGAGCCTTCTAC
CACGACAATGACATCGGCTGGGTAGCGCGACCCAAGCACAACGGCGACGAGGGCTTCGTGCGCAAAGGGAAATTC
AAAAAAGCCAGCAACATGAACTTCGCCCTCAACGCGTCTCAAAAAGTCGAGGCGTACTTGCAGGAGATGGTCGAC
GCAAAGGTCGCCTCGGGCCAGTCCGACCTGGTCGACGAGGCCGACGAGGCCGACATGTACAAGTCGGCGCTGGCG
CGCGTGCTCGAGGAGAACCCGCTGGTATGGGCCGAGGGCGACATCCGGATCGGCGAGATCATCCTCCTCGTCGAC
TCCGACACCCGCGTGCCGGTCGACTGCCTGCTCTACGCCGCGGCCGAACTCTTTCTCTCGCCCGAGGTCGGCATA
ATCCAGCACGCCACGGGTGTGATGCAAGTTAGCCACGATTATTTCGAGAACGCCATTACCTACTTTACCAACCTG
GTCTATACCGCCATCAGCTTCTCTATTAGTTCGGGGGAGTCTGCTCCTTTCGTGGGCCATAACGCCTTTCTCCGA
TGGGGAGCCATCCAGGACGTATGCCCGGAAGAGGTCGAGTACACGCCGTATTGGAGTGAGAGTCACGTCTCTGAA
GACTTCGATATCGCGCTACGATTACAAATGAAAAATTTCATCATCCGGGTGGCGAGTTACCACGGCAATGGGTTC
AAGGAGGGCGTATCGCTCACGGTTTACGACGAGATCATGCGGTGGCAAAAGTACTCGTACGGCGTCAGCGAGATG
ATCTTCCACCCCTTGCACCGCTGGCTCTTCCGGGGGCCCTTCACGCCGCTCTTCTACACCTTCCTGGGCTCCGAC
ATCATGTACTCGTCCAAGATCTCGATCCTGGCGTACATGTGCTCGTACTACGCGCTCGGGGCGGCGCTGCCGCTG
TCGGTCATGAACTACTTCATCGTCGGCTGGTTCCGCGACGAGCTGGCGTCGGTCTACCTGACGTCGTGGAACGTC
TTCCTCTCGCTCGTCGTCGTCTTCAACCTGGCCAGCCCCGTGGCGCTGGCCGTCTACCGGTACCGCACGGGCGAG
CGCTCGCTGCTGGGCGCGCTGTTCGAGAACTTCAAATGGATGCCGGCGATGACGACCTTCTTCGGCGGGATCAGT
TTCCACATCGGCGCCGCCCTGCTCGCCCACCTCTTCCACGTCGACATGCAGTGGGGCGCCACGTCCAAGGAGAAG
GAGGACAGCAACTTCTTCCAGGAGATACCGCGCATCTTCCGCACCTTCAAGATCATGTACCTGGTGCTTTTCCTC
ATTGCCGGCGCCATGATCTACCTCGGCATCTTTGCGCCGCCCGACTGGGCCATCACCGACTTCAGCGTCATCATA
CCGCTCTCTCTCAACCTCGGCTTCCACGCGCTCGTCCCCCTGGTTTTGAATCCGAGTCTTATGATCTTTCACTAT
TAG
Transcript >Hirsu2|3837
ATGGTGAGCTACCTTCACCGGAGGGCCATCGCCAGCGGCTGGATACCCCCGGACTCGGCCCGGAACCACGACGAC
TGCCTGGGCGTCCTGCTGCGGCGCTCCCGCGGCAGCTACGTCACCGCCCCGGACCCTGTCCACGCCGTCCTCCTC
GATGCCTGCCTCCGGCTGAACCTGGCGGTTGCGGTTACCCTTCGGCCGCAGATGCTTGACGGGATCCTCCGCTCG
CTGGCACCGGGCCAGGCCGAACTCAGGTTCAAGGGTGGCTCGCAGATCCAGGTCGTCGAGTCGCTGGCCTCGGTC
AACTCGTCCAACATCAAGAAGTTCCAGTACGCCTTAGTCTCTCGTCAAGAGCACCTAGTCCTCGCGTGGCATGAT
GATTTGGAGCGTATTATTCCGATGGCCACGCAGGTCGAGGAGAAGCTGCTTTCGCTGGTCTGGGGAGAGGGCAAG
CTGCCGTTCAACATCGGCCTGCCCAGCGGCGCTCCCTCCATCATGTCTTCCGGCATGTCCAGCCCCAACGGCACA
ATGACGCCGGCGCTGGAGAAGGCCGGTGCCAAGATCCAAATAAGCGAGAGCACAGAAGAGCTGGAAGAGGACTCG
GGCTTTGAGCGGCCCGAGTCGGTTGAAAGGCCCGTCGCCCGCGCGAGCGCCGTCTTCATCGGCCTCGCCATGTGC
TTAACGCTTTGCCTGTTGCTAGGTGTCTACTGCGGCCAGCTCGTAACTGAATTTTACAGTGGCCAAAAACCTTCG
CTGCGGCGCGCCTACGCAGACGGCTTCGTGCCGCCCAAGATCACCATCCAGATGCCCGTCTACAAGGAGGGCATG
GAGTCGGTCATCATCCCGACCGTCAAAAGTTTGCAAGCCGCCATCTCGTTCTACGAGCTCCGCGGCGGCTCTGCC
AATCTCATGATTTGTGACGACGGTTTGAGAGCCGGCCTCTCAGCTGAAGAGGTTTCGAAGCGACGAGCCTTCTAC
CACGACAATGACATCGGCTGGGTAGCGCGACCCAAGCACAACGGCGACGAGGGCTTCGTGCGCAAAGGGAAATTC
AAAAAAGCCAGCAACATGAACTTCGCCCTCAACGCGTCTCAAAAAGTCGAGGCGTACTTGCAGGAGATGGTCGAC
GCAAAGGTCGCCTCGGGCCAGTCCGACCTGGTCGACGAGGCCGACGAGGCCGACATGTACAAGTCGGCGCTGGCG
CGCGTGCTCGAGGAGAACCCGCTGGTATGGGCCGAGGGCGACATCCGGATCGGCGAGATCATCCTCCTCGTCGAC
TCCGACACCCGCGTGCCGGTCGACTGCCTGCTCTACGCCGCGGCCGAACTCTTTCTCTCGCCCGAGGTCGGCATA
ATCCAGCACGCCACGGGTGTGATGCAAGTTAGCCACGATTATTTCGAGAACGCCATTACCTACTTTACCAACCTG
GTCTATACCGCCATCAGCTTCTCTATTAGTTCGGGGGAGTCTGCTCCTTTCGTGGGCCATAACGCCTTTCTCCGA
TGGGGAGCCATCCAGGACGTATGCCCGGAAGAGGTCGAGTACACGCCGTATTGGAGTGAGAGTCACGTCTCTGAA
GACTTCGATATCGCGCTACGATTACAAATGAAAAATTTCATCATCCGGGTGGCGAGTTACCACGGCAATGGGTTC
AAGGAGGGCGTATCGCTCACGGTTTACGACGAGATCATGCGGTGGCAAAAGTACTCGTACGGCGTCAGCGAGATG
ATCTTCCACCCCTTGCACCGCTGGCTCTTCCGGGGGCCCTTCACGCCGCTCTTCTACACCTTCCTGGGCTCCGAC
ATCATGTACTCGTCCAAGATCTCGATCCTGGCGTACATGTGCTCGTACTACGCGCTCGGGGCGGCGCTGCCGCTG
TCGGTCATGAACTACTTCATCGTCGGCTGGTTCCGCGACGAGCTGGCGTCGGTCTACCTGACGTCGTGGAACGTC
TTCCTCTCGCTCGTCGTCGTCTTCAACCTGGCCAGCCCCGTGGCGCTGGCCGTCTACCGGTACCGCACGGGCGAG
CGCTCGCTGCTGGGCGCGCTGTTCGAGAACTTCAAATGGATGCCGGCGATGACGACCTTCTTCGGCGGGATCAGT
TTCCACATCGGCGCCGCCCTGCTCGCCCACCTCTTCCACGTCGACATGCAGTGGGGCGCCACGTCCAAGGAGAAG
GAGGACAGCAACTTCTTCCAGGAGATACCGCGCATCTTCCGCACCTTCAAGATCATGTACCTGGTGCTTTTCCTC
ATTGCCGGCGCCATGATCTACCTCGGCATCTTTGCGCCGCCCGACTGGGCCATCACCGACTTCAGCGTCATCATA
CCGCTCTCTCTCAACCTCGGCTTCCACGCGCTCGTCCCCCTGGTTTTGAATCCGAGTCTTATGATCTTTCACTAT
TAG
Gene >Hirsu2|3837
ATGGTGAGCTACCTTCACCGGAGGGCCATCGCCAGCGGCTGGATACCCCCGGACTCGGCCCGGAACCACGACGAC
TGCCTGGGCGTCCTGCTGCGGCGCTCCCGCGGCAGCTACGTCACCGCCCCGGACCCTGTCCACGCCGTCCTCCTC
GATGCCTGCCTCCGGCTGAACCTGGCGGTTGCGGTTACCCTTCGGCCGCAGATGCTTGACGGGATCCTCCGCTCG
CTGGCACCGGGCCAGGCCGAACTCAGGTTCAAGGGTGGCTCGCAGATCCAGGTCGTCGAGTCGCTGGCCTCGGTC
AACTCGTCCAACATCAAGAAGTTCCAGTACGCCTTAGTCTCTCGTCAAGAGCACCTAGTCCTCGCGTGGCATGAT
GATTTGGAGCGTATTATTCCGATGGCCACGCAGGTCGAGGAGAAGCTGCTTTCGCTGGTAAGTCCCCTTTATGTT
TTACCCCTTTTCTTTCGACTGACGCGAATTTCCGTCTGCCAGGTCTGGGGAGAGGGCAAGCTGCCGTTCAACATC
GGCCTGCCCAGCGGCGCTCCCTCCATCATGTCTTCCGGCATGTCCAGCCCCAACGGCACAATGACGCCGGCGCTG
GAGAAGGCCGGTGCCAAGATCCAAATAAGCGAGAGCACAGAAGAGCTGGAAGAGGACTCGGGCTTTGAGCGGCCC
GAGTCGGTTGAAAGGCCCGTCGCCCGCGCGAGCGCCGTCTTCATCGGCCTCGCCATGTGCTTAACGCTTTGCCTG
TTGCTAGGTGTCTACTGCGGCCAGCTCGTAACTGAGTGCATCCTCGACGGCTCGTGGACCCGGCTAGCGCTCCTC
CTCGCGGTTCCCCTCCTTGCACTGATCTCACTTTTTTTTTTCGTCATTTTGTGGACCGACCTTTTTCAACTTATT
GGCCCGATTGGTGCTGCTGCCGCCAACTCTAGATTTTACAGTGGCCAAAAACCTTCGCTGCGGCGCGCCTACGCA
GACGGCTTCGTGCCGCCCAAGATCACCATCCAGATGCCCGTCTACAAGGAGGGCATGGAGTCGGTCATCATCCCG
ACCGTCAAAAGTTTGCAAGCCGCCATCTCGTTCTACGAGCTCCGCGGCGGCTCTGCCAATCTCATGATTTGTGAC
GACGGTTTGAGAGCCGGCCTCTCAGCTGAAGAGGTTTCGAAGCGACGAGCCTTCTACCACGACAATGACATCGGC
TGGGTAGCGCGACCCAAGCACAACGGCGACGAGGGCTTCGTGCGCAAAGGGAAATTCAAAAAAGCCAGCAACATG
AACTTCGCCCTCAACGCGTCTCAAAAAGTCGAGGCGTACTTGCAGGAGATGGTCGACGCAAAGGTCGCCTCGGGC
CAGTCCGACCTGGTCGACGAGGCCGACGAGGCCGACATGTACAAGTCGGCGCTGGCGCGCGTGCTCGAGGAGAAC
CCGCTGGTATGGGCCGAGGGCGACATCCGGATCGGCGAGATCATCCTCCTCGTCGACTCCGACACCCGCGTGGTG
AGTGCCTTGTCCTCCGTTGCTGCGACGGCAGCTGACTCGAGATGCAGCCGGTCGACTGCCTGCTCTACGCCGCGG
CCGAACTCTTTCTCTCGCCCGAGGTCGGCATAATCCAGCACGCCACGGGTGTGATGCAAGTTAGCCACGATTATT
TCGAGAACGCCATTACCTACTTTACCAACCTGGTCTATACCGCCATCAGCTTCTCTATTAGTTCGGGGGAGTCTG
CTCCTTTCGTGGGCCATAACGCCTTTCTCCGATGGGGAGGTGAGTGAGTTCCTAGTTCATGCCCCCTTTTCGGCC
CCCTTTCTGGCCTCTCGGCCGTCTGCCCCGCTTTTCGGCCGTCTGGAACTGCCCGCGATGCACATAGCCGGCAGC
ACGTCGTCCGCGGCTAGGTGGCTAATTTGGATACACCCCGTAGCCATCCAGGACGTATGCCCGGAAGAGGTCGAG
TACACGCCGTATTGGAGTGAGAGTCACGTCTCTGAAGACTTCGATATCGCGCTACGATTACAAATGAAAAATTTC
ATCATCCGGGTGGCGAGTTACCACGGCAATGGGTTCAAGGAGGGCGTATCGCTCACGGTTTACGACGAGATCATG
CGGTGGCAAAAGTACTCGTACGGCGTCAGCGAGATGATCTTCCACCCCTTGCACCGCTGGCTCTTCCGGGGGCCC
TTCACGCCGCTCTTCTACACCTTCCTGGGCTCCGACATCATGTACTCGTCCAAGATCTCGATCCTGGCGTACATG
TGCTCGTACTACGCGCTCGGGGCGGCGCTGCCGCTGTCGGTCATGAACTACTTCATCGTCGGCTGGTTCCGCGAC
GAGCTGGCGTCGGTCTACCTGACGTCGTGGAACGTCTTCCTCTCGCTCGTCGTCGTCTTCAACCTGGCCAGCCCC
GTGGCGCTGGCCGTCTACCGGTACCGCACGGGCGAGCGCTCGCTGCTGGGCGCGCTGTTCGAGAACTTCAAATGG
ATGCCGGCGATGACGACCTTCTTCGGCGGGATCAGTTTCCACATCGGCGCCGCCCTGCTCGCCCACCTCTTCCAC
GTCGACATGCAGTGGGGCGCCACGTCCAAGGAGAAGGAGGACAGCAACTTCTTCCAGGAGATACCGCGCATCTTC
CGCACCTTCAAGATCATGTACCTGGTGCTTTTCCTCATTGCCGGCGCCATGATCTACCTCGGCATCTTTGCGCCG
CCCGACTGGGCCATCACCGACTTCAGCGTCATCATACCGCTCTCTCTCAACCTCGGCTTCCACGCGCTCGTCCCC
CTGGTTTTGAATCCGAGTCTTATGATCTTTCACTATTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail