Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3834
Gene name
LocationContig_2021:2503..3964
Strand+
Gene length (bp)1461
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BFU1|S39A9_MOUSE Zinc transporter ZIP9 OS=Mus musculus GN=Slc39a9 PE=2 SV=1 9 415 5.0E-23
sp|Q6NRM1|S399B_XENLA Zinc transporter ZIP9-B OS=Xenopus laevis GN=slc39a9-b PE=2 SV=1 147 415 8.0E-18
sp|Q6NTL1|S399A_XENLA Zinc transporter ZIP9-A OS=Xenopus laevis GN=slc39a9-a PE=2 SV=1 160 415 2.0E-17
sp|Q640S1|S39A9_XENTR Zinc transporter ZIP9 OS=Xenopus tropicalis GN=slc39a9 PE=2 SV=1 147 415 2.0E-17
sp|Q9NUM3|S39A9_HUMAN Zinc transporter ZIP9 OS=Homo sapiens GN=SLC39A9 PE=2 SV=2 144 415 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BFU1|S39A9_MOUSE Zinc transporter ZIP9 OS=Mus musculus GN=Slc39a9 PE=2 SV=1 9 415 5.0E-23
sp|Q6NRM1|S399B_XENLA Zinc transporter ZIP9-B OS=Xenopus laevis GN=slc39a9-b PE=2 SV=1 147 415 8.0E-18
sp|Q6NTL1|S399A_XENLA Zinc transporter ZIP9-A OS=Xenopus laevis GN=slc39a9-a PE=2 SV=1 160 415 2.0E-17
sp|Q640S1|S39A9_XENTR Zinc transporter ZIP9 OS=Xenopus tropicalis GN=slc39a9 PE=2 SV=1 147 415 2.0E-17
sp|Q9NUM3|S39A9_HUMAN Zinc transporter ZIP9 OS=Homo sapiens GN=SLC39A9 PE=2 SV=2 144 415 1.0E-16
sp|Q5ZIU9|S39A9_CHICK Zinc transporter ZIP9 OS=Gallus gallus GN=SLC39A9 PE=2 SV=1 162 415 1.0E-16
sp|Q5BL29|S39A9_DANRE Zinc transporter ZIP9 OS=Danio rerio GN=slc39a9 PE=2 SV=1 151 415 5.0E-16
sp|Q95JP5|S39A9_MACFA Zinc transporter ZIP9 OS=Macaca fascicularis GN=SLC39A9 PE=2 SV=1 228 415 2.0E-13
sp|Q5RE57|S39A9_PONAB Zinc transporter ZIP9 OS=Pongo abelii GN=SLC39A9 PE=2 SV=1 232 415 4.0E-13
sp|Q3KR82|S39A9_RAT Zinc transporter ZIP9 OS=Rattus norvegicus GN=Slc39a9 PE=2 SV=1 158 366 1.0E-12
sp|Q6NRM1|S399B_XENLA Zinc transporter ZIP9-B OS=Xenopus laevis GN=slc39a9-b PE=2 SV=1 9 76 2.0E-07
sp|Q5ZIU9|S39A9_CHICK Zinc transporter ZIP9 OS=Gallus gallus GN=SLC39A9 PE=2 SV=1 7 72 4.0E-07
sp|Q3KR82|S39A9_RAT Zinc transporter ZIP9 OS=Rattus norvegicus GN=Slc39a9 PE=2 SV=1 9 98 4.0E-07
sp|Q6NTL1|S399A_XENLA Zinc transporter ZIP9-A OS=Xenopus laevis GN=slc39a9-a PE=2 SV=1 9 76 6.0E-07
sp|Q9NUM3|S39A9_HUMAN Zinc transporter ZIP9 OS=Homo sapiens GN=SLC39A9 PE=2 SV=2 1 98 8.0E-07
sp|Q640S1|S39A9_XENTR Zinc transporter ZIP9 OS=Xenopus tropicalis GN=slc39a9 PE=2 SV=1 9 72 1.0E-06
sp|Q5BL29|S39A9_DANRE Zinc transporter ZIP9 OS=Danio rerio GN=slc39a9 PE=2 SV=1 18 73 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 33 55 22
3 166 185 19
4 305 327 22
5 337 356 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3834
MAGLILLLVLCVVMALASFLAGALPLSMTLSQSQLRFISSIGVGILVGTSLMVIIPEGIEAAVTPAWSSSHHHRV
RSLAQRDPWGLAIGKRHETPVVHAAAVNWEGSTSKRAPPPVPDAHVPYAATSPLEESSLPDVFVAAAAAEAPAQD
KDDGKDGHDEEDHAEIPAFEVGLSMVLGFVLMFLIDRLPRHATDTFQSAPQTTHMSLDNLEAEGASTDEEADGFL
SSLAPTPRWARSLATTIGLVIHAAADGIAMGASSASSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
ARGHLVVFSLAAPVGALSTWLLINLLGSQHLDGERGQWWTGMLLLFSGGTFLYVAMHAMQEDSGSHSHDHGAAVN
GYGDGQPIGQRKPRGPQMRDTLATVVGIFLPLLTQLGHHHH*
Coding >Hirsu2|3834
ATGGCTGGCCTCATCTTGTTGCTGGTACTATGCGTGGTCATGGCGTTGGCCTCGTTCCTCGCCGGAGCCCTACCG
CTATCCATGACGCTGTCGCAGTCGCAGCTGCGCTTTATATCCAGCATCGGCGTAGGAATCCTCGTGGGCACGTCT
CTCATGGTCATCATTCCCGAAGGGATCGAGGCCGCCGTCACTCCGGCATGGTCGTCCTCCCACCATCATCGGGTG
CGAAGCCTAGCGCAACGAGATCCGTGGGGTTTGGCGATCGGGAAACGCCACGAGACTCCCGTCGTCCATGCCGCG
GCCGTCAACTGGGAGGGCTCGACCAGCAAGCGTGCTCCTCCGCCTGTCCCCGACGCCCATGTGCCTTATGCCGCC
ACGTCCCCCCTGGAGGAGTCGTCGCTTCCGGACGTGTTCGTCGCTGCCGCCGCCGCCGAAGCTCCGGCACAAGAC
AAGGATGATGGGAAAGACGGGCACGATGAGGAAGACCACGCTGAAATCCCGGCGTTCGAGGTCGGCCTCTCCATG
GTTCTAGGCTTTGTCCTCATGTTCCTCATCGACCGACTGCCGAGGCACGCGACCGACACGTTCCAGTCGGCGCCG
CAGACGACGCACATGAGCCTGGACAACCTTGAGGCCGAAGGCGCGTCGACGGACGAGGAGGCCGACGGCTTCCTC
AGCTCCCTGGCGCCGACCCCACGGTGGGCGCGCAGCCTGGCGACGACGATCGGGCTGGTGATCCACGCGGCCGCG
GACGGCATTGCCATGGGCGCGTCGTCGGCCTCGTCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCG
GCTCGCGGCCACCTCGTCGTCTTCAGCCTGGCCGCGCCAGTCGGCGCCCTCTCGACCTGGCTCCTCATCAACCTG
CTGGGCAGCCAGCACCTCGACGGCGAGAGGGGGCAGTGGTGGACGGGTATGCTGCTGCTCTTTTCCGGTGGCACC
TTTCTCTACGTCGCCATGCACGCGATGCAGGAGGATAGCGGCTCACACAGCCACGACCACGGCGCGGCAGTCAAT
GGGTACGGGGACGGGCAGCCGATCGGGCAGCGGAAGCCCCGAGGGCCGCAAATGCGCGACACCCTCGCCACGGTC
GTAGGCATCTTCCTCCCCCTCCTCACGCAGCTGGGCCATCACCACCATTGA
Transcript >Hirsu2|3834
ATGGCTGGCCTCATCTTGTTGCTGGTACTATGCGTGGTCATGGCGTTGGCCTCGTTCCTCGCCGGAGCCCTACCG
CTATCCATGACGCTGTCGCAGTCGCAGCTGCGCTTTATATCCAGCATCGGCGTAGGAATCCTCGTGGGCACGTCT
CTCATGGTCATCATTCCCGAAGGGATCGAGGCCGCCGTCACTCCGGCATGGTCGTCCTCCCACCATCATCGGGTG
CGAAGCCTAGCGCAACGAGATCCGTGGGGTTTGGCGATCGGGAAACGCCACGAGACTCCCGTCGTCCATGCCGCG
GCCGTCAACTGGGAGGGCTCGACCAGCAAGCGTGCTCCTCCGCCTGTCCCCGACGCCCATGTGCCTTATGCCGCC
ACGTCCCCCCTGGAGGAGTCGTCGCTTCCGGACGTGTTCGTCGCTGCCGCCGCCGCCGAAGCTCCGGCACAAGAC
AAGGATGATGGGAAAGACGGGCACGATGAGGAAGACCACGCTGAAATCCCGGCGTTCGAGGTCGGCCTCTCCATG
GTTCTAGGCTTTGTCCTCATGTTCCTCATCGACCGACTGCCGAGGCACGCGACCGACACGTTCCAGTCGGCGCCG
CAGACGACGCACATGAGCCTGGACAACCTTGAGGCCGAAGGCGCGTCGACGGACGAGGAGGCCGACGGCTTCCTC
AGCTCCCTGGCGCCGACCCCACGGTGGGCGCGCAGCCTGGCGACGACGATCGGGCTGGTGATCCACGCGGCCGCG
GACGGCATTGCCATGGGCGCGTCGTCGGCCTCGTCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCG
GCTCGCGGCCACCTCGTCGTCTTCAGCCTGGCCGCGCCAGTCGGCGCCCTCTCGACCTGGCTCCTCATCAACCTG
CTGGGCAGCCAGCACCTCGACGGCGAGAGGGGGCAGTGGTGGACGGGTATGCTGCTGCTCTTTTCCGGTGGCACC
TTTCTCTACGTCGCCATGCACGCGATGCAGGAGGATAGCGGCTCACACAGCCACGACCACGGCGCGGCAGTCAAT
GGGTACGGGGACGGGCAGCCGATCGGGCAGCGGAAGCCCCGAGGGCCGCAAATGCGCGACACCCTCGCCACGGTC
GTAGGCATCTTCCTCCCCCTCCTCACGCAGCTGGGCCATCACCACCATTGA
Gene >Hirsu2|3834
ATGGCTGGCCTCATCTTGTTGCTGGTACTATGCGTCAGTCCGACCGCCCATCCGACCCAGCCTTGCGAGTTTTCT
CAGCTGACAGTCTTCGCTCCCCCAGGTGGTCATGGCGTTGGCGTACGGTTCCCATCGCATCGATAGCCTTTGTTC
GCGTATGTCGGCTTGCTGACACCGGCCGCAGCTCGTTCCTCGCCGGAGCCCTACCGCTATCCATGACGCTGTCGC
AGTCGCAGCTGCGCTTTATATCCAGCATCGGCGTAGGAATCCTCGTGGGCACGTCTCTCATGGTCATCATTCCCG
AAGGGATCGAGGCCGCCGTCACTCCGGCATGGTCGTCCTCCCACCATCATCGGGTGCGAAGCCTAGCGCAACGAG
ATCCGTGGGGTTTGGCGATCGGGAAACGCCACGAGACTCCCGTCGTCCATGCCGCGGCCGTCAACTGGGAGGGCT
CGACCAGCAAGCGTGCTCCTCCGCCTGTCCCCGACGCCCATGTGCCTTATGCCGCCACGTCCCCCCTGGAGGAGT
CGTCGCTTCCGGACGTGTTCGTCGCTGCCGCCGCCGCCGAAGCTCCGGCACAAGACAAGGATGATGGGAAAGACG
GGCACGATGAGGAAGACCACGCTGAAATCCCGGCGTTCGAGGTCGGCCTCTCCATGGTTCTAGGCTTTGTCCTCA
TGTTCCTCATCGACCGACTGCCGAGGCACGCGACCGACACGTTCCAGTCGGCGCCGCAGACGACGCACATGAGCC
TGGACAACCTTGAGGCCGAAGGCGCGTCGACGGACGAGGAGGCCGACGGCTTCCTCAGCTCCCTGGCGCCGACCC
CACGGTGGGCGCGCAGCCTGGCGACGACGATCGGGCTGGTGATCCACGCGGCCGCGGACGGCATTGCCATGGGCG
CGTCGTCGGCCTCGTCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGGCTCGCGGCCACCTCGTCG
TCTTCAGCCTGGCCGCGCCAGTCGGCGCCCTCTCGACCTGGCTCCTCATCAACCTGCTGGGCAGCCAGCACCTCG
ACGGCGAGAGGGGGCAGTGGTGGACGGGTATGCTGCTGCTCTTTTCCGGTGGCACCTTTCTGTGAGAGCTCCCCC
CCCCCTTTTCGGACAAGGGCGGCATGCGGAATGGCGACGAGTTGCTGACGCAAGGGCCTAAACAGCTACGTCGCC
ATGCACGCGATGCAGGAGGATAGCGGCTCACACAGCCACGACCACGGCGCGGCAGTCAATGGGTACGGGGACGGG
CAGCCGATCGGGCAGCGGAAGCCCCGAGGGCCGCAAATGCGCGACACCCTCGCCACGGTCGTAGGCATCTTCCTC
CCCCTCCTCACGCAGCTGGGCCATCACCACCATTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail