Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3832
Gene name
LocationContig_2020:211..3377
Strand-
Gene length (bp)3166
Transcript length (bp)3099
Coding sequence length (bp)3099
Protein length (aa) 1033

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 1.3E-27 267 440
PF09369 DUF1998 Domain of unknown function (DUF1998) 1.8E-20 871 959
PF00271 Helicase_C Helicase conserved C-terminal domain 2.0E-09 498 607
PF04851 ResIII Type III restriction enzyme, res subunit 6.3E-08 264 413

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13983|HRQ1_SCHPO ATP-dependent helicase hrq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrq1 PE=1 SV=4 137 1015 0.0E+00
sp|Q05549|HRQ1_YEAST ATP-dependent helicase HRQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRQ1 PE=1 SV=1 5 1009 0.0E+00
sp|P50830|YPRA_BACSU Uncharacterized ATP-dependent helicase YprA OS=Bacillus subtilis (strain 168) GN=yprA PE=3 SV=1 262 962 5.0E-116
sp|Q58969|Y1574_METJA Uncharacterized ATP-dependent helicase MJ1574 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1574 PE=3 SV=1 243 664 3.0E-44
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 269 607 7.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13983|HRQ1_SCHPO ATP-dependent helicase hrq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrq1 PE=1 SV=4 137 1015 0.0E+00
sp|Q05549|HRQ1_YEAST ATP-dependent helicase HRQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRQ1 PE=1 SV=1 5 1009 0.0E+00
sp|P50830|YPRA_BACSU Uncharacterized ATP-dependent helicase YprA OS=Bacillus subtilis (strain 168) GN=yprA PE=3 SV=1 262 962 5.0E-116
sp|Q58969|Y1574_METJA Uncharacterized ATP-dependent helicase MJ1574 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1574 PE=3 SV=1 243 664 3.0E-44
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 269 607 7.0E-17
sp|O27830|HELX_METTH Uncharacterized ATP-dependent helicase MTH_1802 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1802 PE=3 SV=1 269 619 2.0E-16
sp|P95949|HELX_SULSO Uncharacterized ATP-dependent helicase SSO0112 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0112 PE=3 SV=1 269 619 4.0E-16
sp|P30015|LHR_ECOLI Probable ATP-dependent helicase lhr OS=Escherichia coli (strain K12) GN=lhr PE=3 SV=2 263 605 7.0E-16
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 281 443 4.0E-13
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 249 629 1.0E-12
sp|Q8VID5|RECQ5_MOUSE ATP-dependent DNA helicase Q5 OS=Mus musculus GN=Recql5 PE=1 SV=1 268 624 8.0E-12
sp|A8WK63|RECQ1_CAEBR Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis briggsae GN=CBG24191 PE=3 SV=1 262 606 8.0E-12
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 262 610 2.0E-11
sp|O94762|RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=RECQL5 PE=1 SV=2 268 624 2.0E-11
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 262 629 8.0E-11
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 262 463 1.0E-10
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 281 443 1.0E-10
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 262 612 5.0E-10
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 251 610 6.0E-10
sp|Q9DBN9|DDX59_MOUSE Probable ATP-dependent RNA helicase DDX59 OS=Mus musculus GN=Ddx59 PE=1 SV=1 278 614 1.0E-09
sp|D4ACP5|RECQ5_RAT ATP-dependent DNA helicase Q5 OS=Rattus norvegicus GN=Recql5 PE=1 SV=1 269 624 2.0E-09
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 267 443 3.0E-08
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 281 657 4.0E-08
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 258 545 8.0E-08
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 258 545 8.0E-08
sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 269 619 8.0E-08
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 269 440 2.0E-07
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 218 443 3.0E-07
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 218 443 3.0E-07
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 264 614 4.0E-07
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 262 620 4.0E-07
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 218 443 5.0E-07
sp|P81248|YF7B_METJA Uncharacterized protein MJ1572.1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572.1 PE=4 SV=1 868 985 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3832
MKPAVESHIRRQLSVEEVALVTALRPEGINFTYVDQFTLQLDVDDSERHKTFNAFARPGSQTLVHGSSIGGWGGR
GKVNDRHRFKSASDRTRVLIFEFIDGDPKRQISEKTTEHITRPNKRLRQEMLRTPVYSHKQLTRLIEKRDKKFAN
AINDFLNSCQAQNLDPLAVLQTRAEALVPKMSTQEDNTSEWTPSAIPDHIPKQRKAMADIVKEVKKSPWYSGQIV
PDGHRVFEPQQPIYGHLDFLLSQNLVNALYNAKGIEIEQLYAHQAEALNALQLGQNVVVATSTSSGKSLIYQLPV
LQALERDSSSRAMYIFPTKALAQDQRRSLQEMVKYMPGQETTVIETFDGDTPIDERSFLREHARVIFTNPDMLHA
TILPQEERWRTFMRNLKFVVVDELHHYNGQLGSHVAFAIRRLRRICAAVGNMRVRFISCSATVTNPREHFRTIFG
IDDVRLIDHDGSPSGRKEFICWNTPYNDPGDPASGRGSAKSECARLFCALMLRGVRIIAFCRVRAQCEGLVSAIK
HELESLGRPECVNLVMGYRGGYTAPDRRRIETEMFEGKLLGIVATTALELGVDIGTLDCVMSWGFPYTIANLRQQ
SGRAGRRNRDSLSVLVGDRFATDQHFMHNPGELFTRPNAKLVVDLENLLIREGHIQCAAYEMPLQPEIDAQYFGQ
DLAEVCEARLLRDETGFYNCHPRFRPNPSRYIAIRDTEDTHFAIIDVTNGGNVILEELEAFRAPFTIYDGAVFLH
QGSTYLVKDFLPDKQLAKVERVKVDWTTTQRNFSDIDPVEIEAIRKIPFSLSQAYHGTIRIHQQVFGYIKVDKKG
RVLDAVRIDNPPVIRYSKGMWLDVPKKALEILQGRRLNLAAAIHAAEHAVMSLLPTFVVSTPEDVRTECKVALKE
FAKETQRKRPARLAFYDAKGGAGGSGISSKAFDHIDRLLATALQRVEGCLCQLGCLECVASESCKQSNEVLSKPG
SRIVLRSLLNLDIDFEALPMGPESHSPVGIETVIMAQPICARRSANRPITRKTASSP*
Coding >Hirsu2|3832
ATGAAACCAGCCGTGGAGTCTCACATACGACGGCAGCTATCAGTTGAGGAAGTCGCGTTGGTCACGGCCCTGCGC
CCGGAAGGCATCAATTTCACCTATGTAGACCAGTTCACATTGCAACTCGACGTGGACGACTCGGAAAGGCACAAA
ACATTCAACGCGTTCGCGCGCCCAGGATCTCAGACGCTAGTTCACGGCTCATCTATCGGCGGATGGGGAGGTCGT
GGTAAGGTCAACGATCGTCACCGCTTTAAAAGCGCATCAGACAGAACTCGGGTATTGATTTTCGAGTTTATCGAC
GGCGACCCGAAGCGTCAAATCTCGGAGAAAACTACTGAACATATCACTCGGCCGAATAAAAGGTTGCGTCAAGAG
ATGTTGCGGACGCCCGTCTACAGCCATAAACAGCTAACACGATTGATTGAGAAGCGGGACAAAAAGTTTGCCAAT
GCCATCAATGACTTTCTGAACAGTTGCCAGGCGCAAAATCTTGACCCGTTGGCAGTTCTCCAAACCAGGGCTGAA
GCTCTCGTGCCAAAGATGTCTACGCAGGAGGATAATACTTCAGAATGGACACCTAGCGCGATTCCGGACCACATT
CCGAAGCAGCGAAAGGCCATGGCTGACATCGTGAAGGAAGTCAAGAAAAGCCCGTGGTATTCTGGGCAGATCGTC
CCAGACGGGCACCGAGTCTTTGAACCTCAGCAGCCAATCTACGGCCATCTCGATTTTCTGCTTAGCCAGAACCTG
GTAAATGCTCTTTATAACGCCAAAGGAATTGAGATTGAGCAGCTCTACGCTCACCAAGCTGAGGCCTTAAATGCA
CTCCAATTAGGCCAAAATGTGGTCGTCGCGACATCTACCAGTTCCGGCAAGTCCCTGATCTATCAGCTTCCGGTG
TTGCAGGCCCTGGAGCGCGATTCCAGCTCGCGAGCCATGTATATCTTCCCCACAAAGGCCTTGGCTCAGGATCAA
CGGAGGAGCTTGCAAGAAATGGTGAAGTACATGCCCGGCCAGGAAACCACGGTTATTGAGACCTTTGACGGCGAT
ACCCCGATCGATGAGAGAAGTTTCTTGCGAGAGCATGCGAGGGTCATATTCACGAACCCCGATATGCTTCATGCC
ACAATTCTCCCGCAAGAAGAGAGATGGAGGACGTTTATGAGGAATCTGAAGTTCGTAGTAGTCGACGAGCTCCAC
CACTATAATGGACAATTGGGGTCTCACGTTGCTTTTGCGATCCGGAGATTGAGGCGGATATGCGCTGCTGTTGGC
AACATGCGGGTAAGATTCATCTCTTGCTCTGCCACTGTGACGAACCCTCGAGAGCATTTCCGCACGATCTTCGGT
ATCGACGATGTACGTCTGATCGATCATGATGGGTCTCCGTCGGGACGCAAGGAATTTATTTGTTGGAACACGCCA
TACAATGACCCAGGCGACCCGGCCAGCGGTCGTGGCAGCGCCAAGTCCGAGTGTGCCCGCCTGTTCTGCGCTCTG
ATGTTGAGGGGTGTCAGGATCATAGCATTCTGCCGCGTCCGTGCCCAATGTGAGGGCCTGGTCAGTGCGATCAAA
CACGAACTAGAGTCTCTTGGTCGCCCCGAGTGCGTCAACCTTGTCATGGGATATCGCGGCGGCTATACTGCTCCA
GACCGTCGTCGGATCGAAACTGAGATGTTTGAAGGGAAGCTACTTGGTATTGTGGCAACCACTGCCTTGGAGTTG
GGCGTCGACATAGGTACGCTGGACTGTGTGATGTCGTGGGGATTTCCTTACACGATCGCAAATCTGCGCCAGCAA
AGTGGCCGGGCGGGGCGGCGTAACAGAGACTCTCTCTCGGTTCTGGTTGGAGACCGCTTTGCGACCGACCAGCAC
TTCATGCACAACCCTGGCGAGCTATTCACAAGGCCAAACGCGAAACTTGTTGTTGACCTCGAGAACTTGCTCATC
CGCGAGGGCCACATTCAATGTGCCGCCTACGAGATGCCACTACAACCAGAAATAGATGCTCAGTACTTCGGACAG
GACTTGGCCGAAGTGTGCGAGGCGAGGCTACTCAGAGATGAAACCGGTTTCTATAATTGTCACCCTCGCTTCCGC
CCCAATCCTTCCAGATATATTGCGATTCGAGACACGGAAGATACGCACTTTGCCATTATCGACGTCACGAACGGA
GGCAATGTGATTTTGGAGGAACTGGAAGCTTTTAGAGCGCCTTTCACAATCTACGACGGGGCTGTCTTCCTTCAT
CAGGGGAGTACCTATCTGGTCAAAGACTTCCTTCCCGACAAACAGCTTGCCAAAGTGGAAAGGGTGAAGGTCGAC
TGGACGACAACGCAACGAAACTTCAGCGACATTGACCCAGTAGAGATTGAAGCTATACGCAAGATACCGTTTTCT
CTATCACAGGCCTATCATGGCACCATACGAATACATCAGCAAGTGTTCGGATACATCAAGGTGGATAAAAAGGGT
CGAGTGCTGGATGCTGTTCGAATAGATAACCCACCTGTCATTAGGTACAGCAAGGGCATGTGGCTTGATGTGCCC
AAAAAAGCACTCGAGATCCTGCAGGGTCGTCGACTGAACTTGGCGGCAGCTATCCACGCAGCCGAACACGCCGTC
ATGAGCTTGTTACCGACATTTGTGGTCAGCACCCCCGAAGATGTACGGACTGAGTGCAAAGTGGCTCTAAAGGAA
TTTGCAAAGGAGACGCAGAGGAAGCGGCCAGCGCGGTTGGCGTTTTACGACGCCAAGGGGGGAGCTGGCGGATCG
GGAATCAGTAGCAAGGCTTTCGACCACATTGACCGCCTGCTCGCGACGGCCCTGCAACGAGTTGAAGGGTGCCTA
TGCCAGCTGGGTTGTCTTGAGTGCGTCGCATCCGAGTCGTGCAAGCAGTCTAACGAGGTGTTGAGCAAACCCGGG
AGTCGAATCGTCCTTAGAAGCCTGTTGAACCTGGACATCGATTTCGAAGCGTTGCCCATGGGACCAGAGAGCCAT
AGTCCTGTCGGAATTGAGACTGTGATAATGGCGCAACCGATCTGTGCCAGACGTTCGGCGAATCGTCCAATCACG
AGGAAGACAGCGTCATCTCCTTAA
Transcript >Hirsu2|3832
ATGAAACCAGCCGTGGAGTCTCACATACGACGGCAGCTATCAGTTGAGGAAGTCGCGTTGGTCACGGCCCTGCGC
CCGGAAGGCATCAATTTCACCTATGTAGACCAGTTCACATTGCAACTCGACGTGGACGACTCGGAAAGGCACAAA
ACATTCAACGCGTTCGCGCGCCCAGGATCTCAGACGCTAGTTCACGGCTCATCTATCGGCGGATGGGGAGGTCGT
GGTAAGGTCAACGATCGTCACCGCTTTAAAAGCGCATCAGACAGAACTCGGGTATTGATTTTCGAGTTTATCGAC
GGCGACCCGAAGCGTCAAATCTCGGAGAAAACTACTGAACATATCACTCGGCCGAATAAAAGGTTGCGTCAAGAG
ATGTTGCGGACGCCCGTCTACAGCCATAAACAGCTAACACGATTGATTGAGAAGCGGGACAAAAAGTTTGCCAAT
GCCATCAATGACTTTCTGAACAGTTGCCAGGCGCAAAATCTTGACCCGTTGGCAGTTCTCCAAACCAGGGCTGAA
GCTCTCGTGCCAAAGATGTCTACGCAGGAGGATAATACTTCAGAATGGACACCTAGCGCGATTCCGGACCACATT
CCGAAGCAGCGAAAGGCCATGGCTGACATCGTGAAGGAAGTCAAGAAAAGCCCGTGGTATTCTGGGCAGATCGTC
CCAGACGGGCACCGAGTCTTTGAACCTCAGCAGCCAATCTACGGCCATCTCGATTTTCTGCTTAGCCAGAACCTG
GTAAATGCTCTTTATAACGCCAAAGGAATTGAGATTGAGCAGCTCTACGCTCACCAAGCTGAGGCCTTAAATGCA
CTCCAATTAGGCCAAAATGTGGTCGTCGCGACATCTACCAGTTCCGGCAAGTCCCTGATCTATCAGCTTCCGGTG
TTGCAGGCCCTGGAGCGCGATTCCAGCTCGCGAGCCATGTATATCTTCCCCACAAAGGCCTTGGCTCAGGATCAA
CGGAGGAGCTTGCAAGAAATGGTGAAGTACATGCCCGGCCAGGAAACCACGGTTATTGAGACCTTTGACGGCGAT
ACCCCGATCGATGAGAGAAGTTTCTTGCGAGAGCATGCGAGGGTCATATTCACGAACCCCGATATGCTTCATGCC
ACAATTCTCCCGCAAGAAGAGAGATGGAGGACGTTTATGAGGAATCTGAAGTTCGTAGTAGTCGACGAGCTCCAC
CACTATAATGGACAATTGGGGTCTCACGTTGCTTTTGCGATCCGGAGATTGAGGCGGATATGCGCTGCTGTTGGC
AACATGCGGGTAAGATTCATCTCTTGCTCTGCCACTGTGACGAACCCTCGAGAGCATTTCCGCACGATCTTCGGT
ATCGACGATGTACGTCTGATCGATCATGATGGGTCTCCGTCGGGACGCAAGGAATTTATTTGTTGGAACACGCCA
TACAATGACCCAGGCGACCCGGCCAGCGGTCGTGGCAGCGCCAAGTCCGAGTGTGCCCGCCTGTTCTGCGCTCTG
ATGTTGAGGGGTGTCAGGATCATAGCATTCTGCCGCGTCCGTGCCCAATGTGAGGGCCTGGTCAGTGCGATCAAA
CACGAACTAGAGTCTCTTGGTCGCCCCGAGTGCGTCAACCTTGTCATGGGATATCGCGGCGGCTATACTGCTCCA
GACCGTCGTCGGATCGAAACTGAGATGTTTGAAGGGAAGCTACTTGGTATTGTGGCAACCACTGCCTTGGAGTTG
GGCGTCGACATAGGTACGCTGGACTGTGTGATGTCGTGGGGATTTCCTTACACGATCGCAAATCTGCGCCAGCAA
AGTGGCCGGGCGGGGCGGCGTAACAGAGACTCTCTCTCGGTTCTGGTTGGAGACCGCTTTGCGACCGACCAGCAC
TTCATGCACAACCCTGGCGAGCTATTCACAAGGCCAAACGCGAAACTTGTTGTTGACCTCGAGAACTTGCTCATC
CGCGAGGGCCACATTCAATGTGCCGCCTACGAGATGCCACTACAACCAGAAATAGATGCTCAGTACTTCGGACAG
GACTTGGCCGAAGTGTGCGAGGCGAGGCTACTCAGAGATGAAACCGGTTTCTATAATTGTCACCCTCGCTTCCGC
CCCAATCCTTCCAGATATATTGCGATTCGAGACACGGAAGATACGCACTTTGCCATTATCGACGTCACGAACGGA
GGCAATGTGATTTTGGAGGAACTGGAAGCTTTTAGAGCGCCTTTCACAATCTACGACGGGGCTGTCTTCCTTCAT
CAGGGGAGTACCTATCTGGTCAAAGACTTCCTTCCCGACAAACAGCTTGCCAAAGTGGAAAGGGTGAAGGTCGAC
TGGACGACAACGCAACGAAACTTCAGCGACATTGACCCAGTAGAGATTGAAGCTATACGCAAGATACCGTTTTCT
CTATCACAGGCCTATCATGGCACCATACGAATACATCAGCAAGTGTTCGGATACATCAAGGTGGATAAAAAGGGT
CGAGTGCTGGATGCTGTTCGAATAGATAACCCACCTGTCATTAGGTACAGCAAGGGCATGTGGCTTGATGTGCCC
AAAAAAGCACTCGAGATCCTGCAGGGTCGTCGACTGAACTTGGCGGCAGCTATCCACGCAGCCGAACACGCCGTC
ATGAGCTTGTTACCGACATTTGTGGTCAGCACCCCCGAAGATGTACGGACTGAGTGCAAAGTGGCTCTAAAGGAA
TTTGCAAAGGAGACGCAGAGGAAGCGGCCAGCGCGGTTGGCGTTTTACGACGCCAAGGGGGGAGCTGGCGGATCG
GGAATCAGTAGCAAGGCTTTCGACCACATTGACCGCCTGCTCGCGACGGCCCTGCAACGAGTTGAAGGGTGCCTA
TGCCAGCTGGGTTGTCTTGAGTGCGTCGCATCCGAGTCGTGCAAGCAGTCTAACGAGGTGTTGAGCAAACCCGGG
AGTCGAATCGTCCTTAGAAGCCTGTTGAACCTGGACATCGATTTCGAAGCGTTGCCCATGGGACCAGAGAGCCAT
AGTCCTGTCGGAATTGAGACTGTGATAATGGCGCAACCGATCTGTGCCAGACGTTCGGCGAATCGTCCAATCACG
AGGAAGACAGCGTCATCTCCTTAA
Gene >Hirsu2|3832
ATGAAACCAGCCGTGGAGTCTCACATACGACGGCAGCTATCAGTTGAGGAAGTCGCGTTGGTCACGGCCCTGCGC
CCGGAAGGCATCAATTTCACCTATGTAGACCAGTTCACATTGCAACTCGACGTGGACGACTCGGAAAGGCACAAA
ACATTCAACGCGTTCGCGCGCCCAGGATCTCAGACGCTAGTTCACGGCTCATCTATCGGCGGATGGGGAGGTCGT
GGTAAGGTCAACGATCGTCACCGCTTTAAAAGCGCATCAGACAGAACTCGGGTATTGATTTTCGAGTTTATCGAC
GGCGACCCGAAGCGTCAAATCTCGGAGAAAACTACTGAACATATCACTCGGCCGAATAAAAGGTTGCGTCAAGAG
ATGTTGCGGACGCCCGTCTACAGCCATAAACAGCTAACACGATTGATTGAGAAGCGGGACAAAAAGTTTGCCAAT
GCCATCAATGACTTTCTGAACAGTTGCCAGGCGCAAAATCTTGACCCGTTGGCAGTTCTCCAAACCAGGGCTGAA
GCTCTCGTGCCAAAGATGTCTACGCAGGAGGATAATACTTCAGAATGGACACCTAGCGCGATTCCGGACCACATT
CCGAAGCAGCGAAAGGCCATGGCTGACATCGTGAAGGAAGTCAAGAAAAGCCCGTGGTATTCTGGGCAGATCGTC
CCAGACGGGCACCGAGTCTTTGAACCTCAGCAGCCAATCTACGGCCATCTCGATTTTCTGCTTAGCCAGAACCTG
GTAAATGCTCTTTATAACGCCAAAGGAATTGAGATTGAGCAGCTCTACGCTCACCAAGCTGAGGCCTTAAATGCA
CTCCAATTAGGCCAAAATGTGGTCGTCGCGACATCTACCAGTTCCGGCAAGTCCCTGATCTATCAGCTTCCGGTG
TTGCAGGCCCTGGAGCGCGATTCCAGCTCGCGAGCCATGTATATCTTCCCCACAAAGGCCTTGGCTCAGGATCAA
CGGAGGAGCTTGCAAGAAATGGTGAAGTACATGCCCGGCCAGGAAACCACGGTTATTGAGACCTTTGACGGCGAT
ACCCCGATCGATGAGAGAAGTTTCTTGCGAGAGCATGCGAGGGTCATATTCACGAACCCCGATATGCTTCATGCC
ACAATTCTCCCGCAAGAAGAGAGATGGAGGACGTTTATGAGGAATCTGAAGTTCGTAGTAGGTAAGAGAGAGCAG
TCCCTTCCCAGGTGATCCATTTTATGTGACTGACAAGTGCCATCGAAATCCAGTCGACGAGCTCCACCACTATAA
TGGACAATTGGGGTCTCACGTTGCTTTTGCGATCCGGAGATTGAGGCGGATATGCGCTGCTGTTGGCAACATGCG
GGTAAGATTCATCTCTTGCTCTGCCACTGTGACGAACCCTCGAGAGCATTTCCGCACGATCTTCGGTATCGACGA
TGTACGTCTGATCGATCATGATGGGTCTCCGTCGGGACGCAAGGAATTTATTTGTTGGAACACGCCATACAATGA
CCCAGGCGACCCGGCCAGCGGTCGTGGCAGCGCCAAGTCCGAGTGTGCCCGCCTGTTCTGCGCTCTGATGTTGAG
GGGTGTCAGGATCATAGCATTCTGCCGCGTCCGTGCCCAATGTGAGGGCCTGGTCAGTGCGATCAAACACGAACT
AGAGTCTCTTGGTCGCCCCGAGTGCGTCAACCTTGTCATGGGATATCGCGGCGGCTATACTGCTCCAGACCGTCG
TCGGATCGAAACTGAGATGTTTGAAGGGAAGCTACTTGGTATTGTGGCAACCACTGCCTTGGAGTTGGGCGTCGA
CATAGGTACGCTGGACTGTGTGATGTCGTGGGGATTTCCTTACACGATCGCAAATCTGCGCCAGCAAAGTGGCCG
GGCGGGGCGGCGTAACAGAGACTCTCTCTCGGTTCTGGTTGGAGACCGCTTTGCGACCGACCAGCACTTCATGCA
CAACCCTGGCGAGCTATTCACAAGGCCAAACGCGAAACTTGTTGTTGACCTCGAGAACTTGCTCATCCGCGAGGG
CCACATTCAATGTGCCGCCTACGAGATGCCACTACAACCAGAAATAGATGCTCAGTACTTCGGACAGGACTTGGC
CGAAGTGTGCGAGGCGAGGCTACTCAGAGATGAAACCGGTTTCTATAATTGTCACCCTCGCTTCCGCCCCAATCC
TTCCAGATATATTGCGATTCGAGACACGGAAGATACGCACTTTGCCATTATCGACGTCACGAACGGAGGCAATGT
GATTTTGGAGGAACTGGAAGCTTTTAGAGCGCCTTTCACAATCTACGACGGGGCTGTCTTCCTTCATCAGGGGAG
TACCTATCTGGTCAAAGACTTCCTTCCCGACAAACAGCTTGCCAAAGTGGAAAGGGTGAAGGTCGACTGGACGAC
AACGCAACGAAACTTCAGCGACATTGACCCAGTAGAGATTGAAGCTATACGCAAGATACCGTTTTCTCTATCACA
GGCCTATCATGGCACCATACGAATACATCAGCAAGTGTTCGGATACATCAAGGTGGATAAAAAGGGTCGAGTGCT
GGATGCTGTTCGAATAGATAACCCACCTGTCATTAGGTACAGCAAGGGCATGTGGCTTGATGTGCCCAAAAAAGC
ACTCGAGATCCTGCAGGGTCGTCGACTGAACTTGGCGGCAGCTATCCACGCAGCCGAACACGCCGTCATGAGCTT
GTTACCGACATTTGTGGTCAGCACCCCCGAAGATGTACGGACTGAGTGCAAAGTGGCTCTAAAGGAATTTGCAAA
GGAGACGCAGAGGAAGCGGCCAGCGCGGTTGGCGTTTTACGACGCCAAGGGGGGAGCTGGCGGATCGGGAATCAG
TAGCAAGGCTTTCGACCACATTGACCGCCTGCTCGCGACGGCCCTGCAACGAGTTGAAGGGTGCCTATGCCAGCT
GGGTTGTCTTGAGTGCGTCGCATCCGAGTCGTGCAAGCAGTCTAACGAGGTGTTGAGCAAACCCGGGAGTCGAAT
CGTCCTTAGAAGCCTGTTGAACCTGGACATCGATTTCGAAGCGTTGCCCATGGGACCAGAGAGCCATAGTCCTGT
CGGAATTGAGACTGTGATAATGGCGCAACCGATCTGTGCCAGACGTTCGGCGAATCGTCCAATCACGAGGAAGAC
AGCGTCATCTCCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail