Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3822
Gene name
LocationContig_202:6709..7470
Strand-
Gene length (bp)761
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10233 Cg6151-P Uncharacterized conserved protein CG6151-P 1.4E-39 19 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4R2N5|TVP18_MAGO7 Golgi apparatus membrane protein TVP18 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TVP18 PE=3 SV=1 1 149 4.0E-73
sp|B2AR67|TVP18_PODAN Golgi apparatus membrane protein TVP18 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=TVP18 PE=3 SV=1 1 149 2.0E-69
sp|Q7S693|TVP18_NEUCR Golgi apparatus membrane protein tvp-18 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tvp-18 PE=3 SV=1 1 149 4.0E-65
sp|Q0V0G4|TVP18_PHANO Golgi apparatus membrane protein TVP18 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TVP18 PE=3 SV=2 1 149 6.0E-59
sp|Q4WXT2|TVP18_ASPFU Golgi apparatus membrane protein tvp18 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tvp18 PE=3 SV=1 1 149 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4R2N5|TVP18_MAGO7 Golgi apparatus membrane protein TVP18 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TVP18 PE=3 SV=1 1 149 4.0E-73
sp|B2AR67|TVP18_PODAN Golgi apparatus membrane protein TVP18 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=TVP18 PE=3 SV=1 1 149 2.0E-69
sp|Q7S693|TVP18_NEUCR Golgi apparatus membrane protein tvp-18 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tvp-18 PE=3 SV=1 1 149 4.0E-65
sp|Q0V0G4|TVP18_PHANO Golgi apparatus membrane protein TVP18 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TVP18 PE=3 SV=2 1 149 6.0E-59
sp|Q4WXT2|TVP18_ASPFU Golgi apparatus membrane protein tvp18 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tvp18 PE=3 SV=1 1 149 2.0E-58
sp|B0XXU1|TVP18_ASPFC Golgi apparatus membrane protein tvp18 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tvp18 PE=3 SV=1 1 149 2.0E-58
sp|A6QRX6|TVP18_AJECN Golgi apparatus membrane protein TVP18 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TVP18 PE=3 SV=1 1 149 1.0E-56
sp|A1CKG4|TVP18_ASPCL Golgi apparatus membrane protein tvp18 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tvp18 PE=3 SV=1 1 149 7.0E-56
sp|A1D708|TVP18_NEOFI Golgi apparatus membrane protein tvp18 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tvp18 PE=3 SV=2 1 149 1.0E-55
sp|A6RRF7|TVP18_BOTFB Golgi apparatus membrane protein tvp18 OS=Botryotinia fuckeliana (strain B05.10) GN=tvp18 PE=3 SV=2 1 149 3.0E-55
sp|Q0CNZ5|TVP18_ASPTN Golgi apparatus membrane protein tvp18 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tvp18 PE=3 SV=2 1 149 6.0E-53
sp|A7EMV1|TVP18_SCLS1 Golgi apparatus membrane protein tvp18 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tvp18 PE=3 SV=1 1 149 1.0E-51
sp|Q2GSS4|TVP18_CHAGB Golgi apparatus membrane protein TVP18 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TVP18 PE=3 SV=1 1 142 2.0E-47
sp|Q1E1E0|TVP18_COCIM Golgi apparatus membrane protein TVP18 OS=Coccidioides immitis (strain RS) GN=TVP18 PE=3 SV=1 1 149 3.0E-47
sp|Q6CC06|TVP18_YARLI Golgi apparatus membrane protein TVP18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TVP18 PE=3 SV=1 1 149 8.0E-44
sp|O74375|TVP18_SCHPO Golgi apparatus membrane protein tvp18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tvp18 PE=3 SV=1 6 144 6.0E-39
sp|A5DEQ7|TVP18_PICGU Golgi apparatus membrane protein TVP18 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TVP18 PE=3 SV=2 6 143 3.0E-33
sp|A5DSM9|TVP18_LODEL Golgi apparatus membrane protein TVP18 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TVP18 PE=3 SV=1 3 143 5.0E-32
sp|Q6CMQ1|TVP18_KLULA Golgi apparatus membrane protein TVP18 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TVP18 PE=3 SV=1 6 143 4.0E-31
sp|Q6BWE7|TVP18_DEBHA Golgi apparatus membrane protein TVP18 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TVP18 PE=3 SV=1 4 137 1.0E-29
sp|Q5APC0|TVP18_CANAL Golgi apparatus membrane protein TVP18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TVP18 PE=3 SV=1 3 137 1.0E-29
sp|A3LPS1|TVP18_PICST Golgi apparatus membrane protein TVP18 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TVP18 PE=3 SV=1 3 137 8.0E-27
sp|Q04767|TVP18_YEAST Golgi apparatus membrane protein TVP18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TVP18 PE=1 SV=1 5 141 2.0E-26
sp|A6ZMD0|TVP18_YEAS7 Golgi apparatus membrane protein TVP18 OS=Saccharomyces cerevisiae (strain YJM789) GN=TVP18 PE=3 SV=1 5 141 2.0E-26
sp|Q6FN38|TVP18_CANGA Golgi apparatus membrane protein TVP18 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TVP18 PE=3 SV=1 3 137 3.0E-25
sp|Q750M8|TVP18_ASHGO Golgi apparatus membrane protein TVP18 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TVP18 PE=3 SV=1 6 134 3.0E-24
sp|A7TS55|TVP18_VANPO Golgi apparatus membrane protein TVP18 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TVP18 PE=3 SV=2 5 133 5.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 40 62 22
3 83 105 22
4 109 128 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3822
MTLKEEFQTRNFSIYGQWLGILSMIICLATGISTIFTFTIGLIIFCALAIASSFLILFIEVPLLLRICPTSGKFD
EFVRKISTNYMRAGAYGVMAVIQFVSTVFGRSALIAAGVFLMLTAICYLLAGVKGQAFVGSKTLGGQGVAQMIV*
Coding >Hirsu2|3822
ATGACGCTCAAGGAAGAGTTCCAGACGAGAAACTTTAGCATCTACGGACAATGGCTTGGCATCTTGTCCATGATC
ATTTGTCTCGCGACCGGCATCTCGACCATCTTCACCTTCACCATCGGCCTCATCATCTTTTGCGCCCTGGCCATC
GCCTCGTCGTTCCTCATCCTATTCATCGAGGTGCCCCTGCTGCTCCGCATCTGCCCGACCTCTGGCAAATTCGAT
GAGTTTGTGCGCAAGATCTCGACCAACTACATGCGTGCGGGCGCGTACGGGGTCATGGCCGTCATCCAGTTCGTC
AGCACCGTCTTCGGCAGGAGTGCCCTGATCGCCGCCGGCGTCTTCCTCATGCTCACGGCCATCTGCTACCTGCTT
GCGGGCGTCAAGGGACAGGCCTTTGTGGGGAGCAAGACTCTGGGCGGCCAGGGCGTCGCGCAGATGATTGTGTAA
Transcript >Hirsu2|3822
ATGACGCTCAAGGAAGAGTTCCAGACGAGAAACTTTAGCATCTACGGACAATGGCTTGGCATCTTGTCCATGATC
ATTTGTCTCGCGACCGGCATCTCGACCATCTTCACCTTCACCATCGGCCTCATCATCTTTTGCGCCCTGGCCATC
GCCTCGTCGTTCCTCATCCTATTCATCGAGGTGCCCCTGCTGCTCCGCATCTGCCCGACCTCTGGCAAATTCGAT
GAGTTTGTGCGCAAGATCTCGACCAACTACATGCGTGCGGGCGCGTACGGGGTCATGGCCGTCATCCAGTTCGTC
AGCACCGTCTTCGGCAGGAGTGCCCTGATCGCCGCCGGCGTCTTCCTCATGCTCACGGCCATCTGCTACCTGCTT
GCGGGCGTCAAGGGACAGGCCTTTGTGGGGAGCAAGACTCTGGGCGGCCAGGGCGTCGCGCAGATGATTGTGTAA
Gene >Hirsu2|3822
ATGACGCTCAAGGAAGAGTTCCAGACGAGAAACTTTAGTGCGTGCTCGCGCGCCGGGCTCCGTCCCGGCCTCGCT
CTTGCTGACCCTTCGCGTAGGCATCTACGGACAATGGTAAGCTCGCGGCACCCCCCTCAGGCGCGCCCCGAGCTC
CTCTCTCGCAAGCTCCCCCCCCCGTCTGCGAGTTGCTGTCGAGTGCGGACCGCTACGGCGAGTAGATGAGCTACG
CGTGCCTCGCCGTATACGATGGCGCCCGGACGACCAGGCTTGCCCGGGCGGCACAAAGACTGATTAGCACCCTAC
ACACAGGCTTGGCATCTTGTCCATGATCATTTGTCTCGCGACCGGCATCTCGACCATCTTCACCTTCACCATCGG
CCTCATCATCTTTTGCGCCCTGGCCATGTAGGTTGCCTACGAAACATGCGTGGATGAGCTCGCGCGACTGACCGC
CATCGTCCAGCGCCTCGTCGTTCCTCATCCTATTCATCGAGGTGCCCCTGCTGCTCCGCATCTGCCCGACCTCTG
GCAAATTCGATGAGTTTGTGCGCAAGATCTCGACCAACTACATGCGTGCGGGCGCGTACGGGGTCATGGCCGTCA
TCCAGTTCGTCAGCACCGTCTTCGGCAGGAGTGCCCTGATCGCCGCCGGCGTCTTCCTCATGCTCACGGCCATCT
GCTACCTGCTTGCGGGCGTCAAGGGACAGGCCTTTGTGGGGAGCAAGACTCTGGGCGGCCAGGGCGTCGCGCAGA
TGATTGTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail