Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|382
Gene name
LocationContig_1073:6146..7087
Strand+
Gene length (bp)941
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02037 SAP SAP domain 6.6E-13 4 37
PF18592 Tho1_MOS11_C Tho1/MOS11 C-terminal domain 4.7E-06 145 185

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74871|YCW3_SCHPO Uncharacterized protein C31H12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC31H12.03c PE=1 SV=1 1 279 3.0E-17
sp|P40040|THO1_YEAST Protein THO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THO1 PE=1 SV=1 1 183 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|382
MAEYSSLKVPELKKLLAEKKLPQTGNKADLIARLQDDDKKNATSPSAVDSAARPQEKEDEITYTDDEESAPPPAP
AAASPAAAAKASESKPAEDDQQGEKDKEEERAPAAAELTTAQEPVEKEEDAKSEPVPSEPAQSFALGLDKTAAEA
EAKKRADRAKRFGIEEDDESKKRADRAKRFGIDETELASGLDSALPERPLKRGRGRGGDDDTRSSKRQNFDRRGD
QRGDRRGDRNGRDTRVTRNTRQTRSNGQARNGGILDDPAERAKAEKRAARFAAA*
Coding >Hirsu2|382
ATGGCGGAGTACTCCTCGCTCAAGGTCCCGGAGCTCAAGAAGCTCCTGGCGGAGAAGAAGCTACCCCAGACAGGC
AACAAGGCCGACCTGATCGCCCGCCTGCAAGACGACGACAAGAAGAACGCGACGAGCCCTTCAGCCGTCGATTCC
GCTGCCCGACCGCAGGAGAAGGAGGACGAGATCACGTATACCGACGACGAGGAGTCGGCCCCTCCCCCCGCCCCT
GCGGCTGCTTCCCCCGCGGCAGCAGCAAAGGCTAGTGAATCAAAGCCTGCCGAGGACGACCAGCAAGGTGAAAAG
GACAAGGAGGAAGAGCGCGCTCCTGCGGCTGCTGAACTCACCACCGCCCAGGAGCCTGTCGAGAAAGAGGAAGAC
GCCAAGAGCGAGCCGGTCCCTTCCGAGCCGGCCCAGTCGTTCGCTCTGGGCCTTGACAAGACCGCTGCCGAGGCC
GAGGCCAAGAAGCGCGCCGACAGGGCCAAGCGCTTCGGCATCGAGGAGGATGACGAGTCCAAGAAACGCGCCGAC
CGGGCCAAACGCTTCGGCATCGACGAGACGGAACTGGCCTCAGGCCTCGACTCGGCCCTGCCCGAGAGGCCGCTC
AAGCGCGGCCGTGGCCGGGGCGGCGACGACGACACACGCTCCAGCAAGCGACAGAATTTCGACAGGCGCGGCGAC
CAACGCGGCGACCGACGAGGTGATCGGAACGGGCGCGACACTCGCGTCACTCGCAACACTCGACAGACCCGTAGC
AATGGCCAGGCCAGGAATGGAGGCATCCTGGACGACCCTGCCGAGAGAGCCAAGGCGGAAAAGCGAGCTGCCCGA
TTTGCTGCGGCCTAG
Transcript >Hirsu2|382
ATGGCGGAGTACTCCTCGCTCAAGGTCCCGGAGCTCAAGAAGCTCCTGGCGGAGAAGAAGCTACCCCAGACAGGC
AACAAGGCCGACCTGATCGCCCGCCTGCAAGACGACGACAAGAAGAACGCGACGAGCCCTTCAGCCGTCGATTCC
GCTGCCCGACCGCAGGAGAAGGAGGACGAGATCACGTATACCGACGACGAGGAGTCGGCCCCTCCCCCCGCCCCT
GCGGCTGCTTCCCCCGCGGCAGCAGCAAAGGCTAGTGAATCAAAGCCTGCCGAGGACGACCAGCAAGGTGAAAAG
GACAAGGAGGAAGAGCGCGCTCCTGCGGCTGCTGAACTCACCACCGCCCAGGAGCCTGTCGAGAAAGAGGAAGAC
GCCAAGAGCGAGCCGGTCCCTTCCGAGCCGGCCCAGTCGTTCGCTCTGGGCCTTGACAAGACCGCTGCCGAGGCC
GAGGCCAAGAAGCGCGCCGACAGGGCCAAGCGCTTCGGCATCGAGGAGGATGACGAGTCCAAGAAACGCGCCGAC
CGGGCCAAACGCTTCGGCATCGACGAGACGGAACTGGCCTCAGGCCTCGACTCGGCCCTGCCCGAGAGGCCGCTC
AAGCGCGGCCGTGGCCGGGGCGGCGACGACGACACACGCTCCAGCAAGCGACAGAATTTCGACAGGCGCGGCGAC
CAACGCGGCGACCGACGAGGTGATCGGAACGGGCGCGACACTCGCGTCACTCGCAACACTCGACAGACCCGTAGC
AATGGCCAGGCCAGGAATGGAGGCATCCTGGACGACCCTGCCGAGAGAGCCAAGGCGGAAAAGCGAGCTGCCCGA
TTTGCTGCGGCCTAG
Gene >Hirsu2|382
ATGGCGGAGTACTCCTCGCTCAAGGTCCCGGAGCTCAAGAAGCTCCTGGCGGAGAAGAAGCTACCCCAGACAGGC
AACAAGGCCGACCTGATCGCCCGCCTGCAAGACGACGACAAGAAGAACGCGACGAGCCCTTCAGCCGTCGATTCC
GGTAAGCACAGCTTTCTCAAAAGCAGGGGCTATTCTTGGCCTCGCTCATCCTCGGCGCTTTGGCTGCTCGCACCC
GCCGCAAACAGCTGACAGCGCAACCAGCTGCCCGACCGCAGGAGAAGGAGGACGAGATCACGTATACCGACGACG
AGGAGTCGGCCCCTCCCCCCGCCCCTGCGGCTGCTTCCCCCGCGGCAGCAGCAAAGGCTAGTGAATCAAAGCCTG
CCGAGGACGACCAGCAAGGTGAAAAGGACAAGGAGGAAGAGCGCGCTCCTGCGGCTGCTGAACTCACCACCGCCC
AGGAGCCTGTCGAGAAAGAGGAAGACGCCAAGAGCGAGCCGGTCCCTTCCGAGCCGGCCCAGTCGTTCGCTCTGG
GCCTTGACAAGACCGCTGCCGAGGCCGAGGCCAAGAAGCGCGCCGACAGGGCCAAGCGCTTCGGCATCGAGGAGG
ATGACGAGTCCAAGAAACGCGCCGACCGGGCCAAACGCTTCGGCATCGACGAGACGGAACTGGCCTCAGGCCTCG
ACTCGGCCCTGCCCGAGAGGCCGCTCAAGCGCGGCCGTGGCCGGGGCGGCGACGACGACACACGCTCCAGCAAGC
GACAGAATTTCGACAGGCGCGGCGACCAACGCGGCGACCGACGAGGTGATCGGAACGGGCGCGACACTCGCGTCA
CTCGCAACACTCGACAGACCCGTAGCAATGGCCAGGCCAGGAATGGAGGCATCCTGGACGACCCTGCCGAGAGAG
CCAAGGCGGAAAAGCGAGCTGCCCGATTTGCTGCGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail