Protein ID | Hirsu2|3812 |
Gene name | |
Location | Contig_2016:1304..2403 |
Strand | + |
Gene length (bp) | 1099 |
Transcript length (bp) | 690 |
Coding sequence length (bp) | 690 |
Protein length (aa) | 230 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00227 | Proteasome | Proteasome subunit | 6.1E-45 | 26 | 207 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P38624|PSB1_YEAST | Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2 | 12 | 221 | 1.0E-108 |
sp|O43063|PSB1_SCHPO | Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre3 PE=3 SV=1 | 11 | 222 | 5.0E-93 |
sp|P28073|PSB6_RAT | Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3 | 25 | 226 | 6.0E-84 |
sp|Q60692|PSB6_MOUSE | Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3 | 25 | 221 | 2.0E-83 |
sp|P28072|PSB6_HUMAN | Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4 | 25 | 221 | 2.0E-83 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P38624|PSB1_YEAST | Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2 | 12 | 221 | 1.0E-108 |
sp|O43063|PSB1_SCHPO | Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre3 PE=3 SV=1 | 11 | 222 | 5.0E-93 |
sp|P28073|PSB6_RAT | Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3 | 25 | 226 | 6.0E-84 |
sp|Q60692|PSB6_MOUSE | Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3 | 25 | 221 | 2.0E-83 |
sp|P28072|PSB6_HUMAN | Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4 | 25 | 221 | 2.0E-83 |
sp|Q3MHN0|PSB6_BOVIN | Proteasome subunit beta type-6 OS=Bos taurus GN=PSMB6 PE=1 SV=1 | 25 | 221 | 2.0E-83 |
sp|Q55GJ6|PSB6_DICDI | Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1 | 26 | 217 | 4.0E-76 |
sp|P93395|PSB6_TOBAC | Proteasome subunit beta type-6 OS=Nicotiana tabacum PE=2 SV=1 | 16 | 229 | 6.0E-65 |
sp|Q8LD27|PSB6_ARATH | Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2 | 27 | 229 | 5.0E-63 |
sp|A7KE01|PB6LA_SALSA | Proteasome subunit beta type-6-A like protein OS=Salmo salar GN=psmb6l-a PE=3 SV=1 | 26 | 220 | 2.0E-61 |
sp|A7KII6|PB6LB_SALSA | Proteasome subunit beta type-6-B like protein OS=Salmo salar GN=psmb6l-b PE=3 SV=1 | 26 | 220 | 1.0E-60 |
sp|P28065|PSB9_HUMAN | Proteasome subunit beta type-9 OS=Homo sapiens GN=PSMB9 PE=1 SV=2 | 22 | 219 | 2.0E-60 |
sp|Q3SZC2|PSB9_BOVIN | Proteasome subunit beta type-9 OS=Bos taurus GN=PSMB9 PE=1 SV=1 | 22 | 221 | 5.0E-60 |
sp|Q9DD33|PSB9_SALSA | Proteasome subunit beta type-9 OS=Salmo salar GN=psmb9-a PE=2 SV=1 | 25 | 219 | 3.0E-58 |
sp|Q9PT26|PSB9_ONCMY | Proteasome subunit beta type-9 OS=Oncorhynchus mykiss GN=psmb9 PE=2 SV=1 | 19 | 219 | 4.0E-58 |
sp|Q8SR11|PSB1_ENCCU | Probable proteasome subunit beta type-1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE3 PE=1 SV=1 | 29 | 221 | 9.0E-58 |
sp|P28077|PSB9_RAT | Proteasome subunit beta type-9 OS=Rattus norvegicus GN=Psmb9 PE=1 SV=2 | 21 | 229 | 4.0E-57 |
sp|O35521|PSB9_MUSTR | Proteasome subunit beta type-9 OS=Mus terricolor GN=Psmb9 PE=1 SV=1 | 21 | 221 | 2.0E-56 |
sp|P28076|PSB9_MOUSE | Proteasome subunit beta type-9 OS=Mus musculus GN=Psmb9 PE=1 SV=1 | 21 | 229 | 1.0E-55 |
sp|O35524|PSB9_MUSSI | Proteasome subunit beta type-9 OS=Mus spicilegus GN=Psmb9 PE=1 SV=1 | 21 | 221 | 1.0E-55 |
sp|Q8UW64|PSB9_ORYLA | Proteasome subunit beta type-9 OS=Oryzias latipes GN=psmb9 PE=3 SV=1 | 25 | 219 | 1.0E-55 |
sp|O35523|PSB9_MUSPL | Proteasome subunit beta type-9 OS=Mus platythrix GN=Psmb9 PE=1 SV=1 | 21 | 221 | 2.0E-55 |
sp|O35522|PSB9_MUSMB | Proteasome subunit beta type-9 OS=Mus musculus bactrianus GN=Psmb9 PE=1 SV=1 | 21 | 229 | 6.0E-55 |
sp|Q7DLS1|PSB7B_ARATH | Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2 | 29 | 210 | 7.0E-27 |
sp|O23710|PSB7A_ARATH | Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2 | 29 | 210 | 3.0E-26 |
sp|Q99436|PSB7_HUMAN | Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 | 29 | 221 | 3.0E-26 |
sp|P70195|PSB7_MOUSE | Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 | 29 | 221 | 2.0E-25 |
sp|Q2TBP0|PSB7_BOVIN | Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1 | 29 | 221 | 3.0E-25 |
sp|A1XQU1|PSB7_PIG | Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2 | 29 | 221 | 4.0E-25 |
sp|Q9JHW0|PSB7_RAT | Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 | 29 | 221 | 4.0E-25 |
sp|P25043|PSB2_YEAST | Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1 | 20 | 208 | 2.0E-23 |
sp|Q09841|PSB2_SCHPO | Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 | 29 | 213 | 5.0E-23 |
sp|A3CUS9|PSB_METMJ | Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 | 25 | 217 | 1.0E-22 |
sp|D3RX66|PSB_FERPA | Proteasome subunit beta OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO) GN=psmB PE=3 SV=1 | 29 | 211 | 3.0E-22 |
sp|C7P6N4|PSB_METFA | Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 | 25 | 212 | 5.0E-22 |
sp|Q4KM35|PSB10_RAT | Proteasome subunit beta type-10 OS=Rattus norvegicus GN=Psmb10 PE=2 SV=1 | 15 | 213 | 1.0E-21 |
sp|Q8ZYF2|PSB1_PYRAE | Proteasome subunit beta 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB1 PE=3 SV=1 | 30 | 218 | 1.0E-21 |
sp|P40306|PSB10_HUMAN | Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1 | 29 | 225 | 2.0E-21 |
sp|Q9YER0|PSB2_AERPE | Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 | 26 | 220 | 5.0E-21 |
sp|D3S8M7|PSB_METSF | Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 | 25 | 212 | 6.0E-21 |
sp|O35955|PSB10_MOUSE | Proteasome subunit beta type-10 OS=Mus musculus GN=Psmb10 PE=1 SV=1 | 29 | 220 | 1.0E-20 |
sp|P34065|PSB5_CHICK | Proteasome subunit beta type-5 (Fragment) OS=Gallus gallus GN=PSMB5 PE=2 SV=2 | 29 | 215 | 1.0E-20 |
sp|P28064|PSB8_RAT | Proteasome subunit beta type-8 OS=Rattus norvegicus GN=Psmb8 PE=1 SV=3 | 17 | 212 | 2.0E-20 |
sp|Q58634|PSB_METJA | Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 | 25 | 212 | 2.0E-20 |
sp|B1YA36|PSB1_PYRNV | Proteasome subunit beta 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB1 PE=3 SV=1 | 30 | 218 | 2.0E-20 |
sp|Q2FQL8|PSB_METHJ | Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 | 29 | 226 | 3.0E-20 |
sp|A9A2U7|PSB2_NITMS | Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 | 29 | 212 | 3.0E-20 |
sp|Q5W416|PSB8_CANLF | Proteasome subunit beta type-8 OS=Canis lupus familiaris GN=PSMB8 PE=1 SV=1 | 3 | 212 | 5.0E-20 |
sp|A7I841|PSB_METB6 | Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 | 29 | 216 | 6.0E-20 |
sp|P28063|PSB8_MOUSE | Proteasome subunit beta type-8 OS=Mus musculus GN=Psmb8 PE=1 SV=2 | 10 | 212 | 8.0E-20 |
sp|B8GG66|PSB_METPE | Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 | 21 | 210 | 1.0E-19 |
sp|Q46G14|PSB_METBF | Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 | 29 | 215 | 1.0E-19 |
sp|Q8PZ04|PSB_METMA | Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 | 29 | 215 | 1.0E-19 |
sp|B1L6X8|PSB2_KORCO | Proteasome subunit beta 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB2 PE=3 SV=1 | 33 | 220 | 2.0E-19 |
sp|A1RTI7|PSB2_PYRIL | Proteasome subunit beta 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB2 PE=3 SV=1 | 30 | 215 | 2.0E-19 |
sp|A0B5B1|PSB_METTP | Proteasome subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=psmB PE=3 SV=1 | 29 | 225 | 2.0E-19 |
sp|C9REN7|PSB_METVM | Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 | 29 | 212 | 2.0E-19 |
sp|Q54QR2|PSB7_DICDI | Proteasome subunit beta type-7 OS=Dictyostelium discoideum GN=psmB7 PE=3 SV=1 | 4 | 212 | 2.0E-19 |
sp|Q8TW10|PSB_METKA | Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 | 29 | 217 | 3.0E-19 |
sp|A2SS78|PSB_METLZ | Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 | 25 | 221 | 5.0E-19 |
sp|A4WH05|PSB1_PYRAR | Proteasome subunit beta 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB1 PE=3 SV=1 | 30 | 218 | 8.0E-19 |
sp|P28062|PSB8_HUMAN | Proteasome subunit beta type-8 OS=Homo sapiens GN=PSMB8 PE=1 SV=3 | 3 | 212 | 1.0E-18 |
sp|Q3T0T1|PSB10_BOVIN | Proteasome subunit beta type-10 OS=Bos taurus GN=PSMB10 PE=1 SV=1 | 29 | 213 | 1.0E-18 |
sp|Q0W2D6|PSB_METAR | Proteasome subunit beta OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=psmB PE=3 SV=1 | 29 | 209 | 2.0E-18 |
sp|Q5R8S2|PSB5_PONAB | Proteasome subunit beta type-5 OS=Pongo abelii GN=PSMB5 PE=2 SV=3 | 7 | 212 | 2.0E-18 |
sp|P28074|PSB5_HUMAN | Proteasome subunit beta type-5 OS=Homo sapiens GN=PSMB5 PE=1 SV=3 | 7 | 212 | 2.0E-18 |
sp|Q32KL2|PSB5_BOVIN | Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 | 25 | 212 | 2.0E-18 |
sp|Q12YV7|PSB_METBU | Proteasome subunit beta OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=psmB PE=3 SV=1 | 19 | 215 | 2.0E-18 |
sp|A4WMZ0|PSB2_PYRAR | Proteasome subunit beta 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB2 PE=3 SV=1 | 25 | 216 | 2.0E-18 |
sp|Q9LIP2|PSB5B_ARATH | Proteasome subunit beta type-5-B OS=Arabidopsis thaliana GN=PBE2 PE=1 SV=1 | 16 | 202 | 3.0E-18 |
sp|A3MS44|PSB1_PYRCJ | Proteasome subunit beta 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB1 PE=3 SV=1 | 30 | 218 | 4.0E-18 |
sp|O55234|PSB5_MOUSE | Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3 | 25 | 212 | 4.0E-18 |
sp|Q74MP5|PSB_NANEQ | Proteasome subunit beta OS=Nanoarchaeum equitans (strain Kin4-M) GN=psmB PE=3 SV=1 | 30 | 219 | 4.0E-18 |
sp|Q54BC8|PSB5_DICDI | Proteasome subunit beta type-5 OS=Dictyostelium discoideum GN=psmB5 PE=1 SV=1 | 22 | 212 | 5.0E-18 |
sp|Q8TJB5|PSB_METAC | Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 | 29 | 215 | 5.0E-18 |
sp|Q9P992|PSB_METTE | Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 | 29 | 215 | 5.0E-18 |
sp|O24361|PSB5_SPIOL | Proteasome subunit beta type-5 OS=Spinacia oleracea PE=2 SV=1 | 17 | 203 | 6.0E-18 |
sp|O23717|PSB5A_ARATH | Proteasome subunit beta type-5-A OS=Arabidopsis thaliana GN=PBE1 PE=1 SV=1 | 29 | 202 | 7.0E-18 |
sp|D2RGT4|PSB_ARCPA | Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 | 29 | 212 | 8.0E-18 |
sp|D3E0A3|PSB_METRM | Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 | 29 | 212 | 8.0E-18 |
sp|A6VK02|PSB_METM7 | Proteasome subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmB PE=3 SV=1 | 29 | 214 | 9.0E-18 |
sp|A9A788|PSB_METM6 | Proteasome subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmB PE=3 SV=1 | 29 | 214 | 9.0E-18 |
sp|P28075|PSB5_RAT | Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3 | 25 | 212 | 1.0E-17 |
sp|Q8SQN7|PSB2_ENCCU | Probable proteasome subunit beta type-2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PUP1 PE=1 SV=1 | 29 | 214 | 2.0E-17 |
sp|A4FYA5|PSB_METM5 | Proteasome subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmB PE=3 SV=1 | 29 | 212 | 2.0E-17 |
sp|A0RXV1|PSB2_CENSY | Proteasome subunit beta 2 OS=Cenarchaeum symbiosum (strain A) GN=psmB2 PE=3 SV=2 | 29 | 212 | 3.0E-17 |
sp|A1RX71|PSB2_THEPD | Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 | 25 | 218 | 4.0E-17 |
sp|Q9P996|PSB_ARCFU | Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 | 29 | 210 | 4.0E-17 |
sp|A8AB58|PSB2_IGNH4 | Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 | 29 | 227 | 5.0E-17 |
sp|A3MXQ6|PSB2_PYRCJ | Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 | 25 | 213 | 6.0E-17 |
sp|A1RWY6|PSB1_THEPD | Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 | 23 | 212 | 6.0E-17 |
sp|C7LYP7|PSB_ACIFD | Proteasome subunit beta OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=prcB PE=3 SV=1 | 25 | 201 | 8.0E-17 |
sp|Q3T112|PSB8_BOVIN | Proteasome subunit beta type-8 OS=Bos taurus GN=PSMB8 PE=1 SV=2 | 3 | 212 | 1.0E-16 |
sp|Q975D1|PSB2_SULTO | Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 | 29 | 220 | 1.0E-16 |
sp|A6USJ3|PSB_METVS | Proteasome subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmB PE=3 SV=1 | 29 | 212 | 1.0E-16 |
sp|B1L6S7|PSB1_KORCO | Proteasome subunit beta 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB1 PE=3 SV=1 | 29 | 214 | 1.0E-16 |
sp|Q9YES4|PSB1_AERPE | Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 | 29 | 212 | 2.0E-16 |
sp|Q8ZST5|PSB2_PYRAE | Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 | 25 | 213 | 2.0E-16 |
sp|B1YDJ0|PSB2_PYRNV | Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 | 25 | 213 | 3.0E-16 |
sp|Q6LZD4|PSB_METMP | Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=psmB PE=3 SV=1 | 29 | 212 | 3.0E-16 |
sp|D4GYZ1|PSB_HALVD | Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 | 19 | 216 | 4.0E-16 |
sp|Q6L181|PSB_PICTO | Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 | 18 | 212 | 4.0E-16 |
sp|A1RSJ8|PSB1_PYRIL | Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 | 25 | 213 | 5.0E-16 |
sp|Q2NI68|PSB_METST | Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 | 29 | 212 | 8.0E-16 |
sp|Q47NZ4|PSB_THEFY | Proteasome subunit beta OS=Thermobifida fusca (strain YX) GN=prcB PE=3 SV=1 | 30 | 201 | 1.0E-15 |
sp|A6UT20|PSB_META3 | Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 | 29 | 212 | 1.0E-15 |
sp|P30656|PSB5_YEAST | Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE2 PE=1 SV=3 | 23 | 216 | 2.0E-15 |
sp|O50110|PSB2_PYRHO | Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 | 29 | 212 | 2.0E-15 |
sp|A3DN27|PSB2_STAMF | Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 | 30 | 208 | 2.0E-15 |
sp|Q8U125|PSB2_PYRFU | Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 | 18 | 212 | 2.0E-15 |
sp|D1Z199|PSB_METPS | Proteasome subunit beta OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=psmB PE=3 SV=1 | 29 | 209 | 6.0E-15 |
sp|D5EAS6|PSB_METMS | Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 | 19 | 215 | 7.0E-15 |
sp|B5IEE5|PSB_ACIB4 | Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 | 38 | 210 | 1.0E-14 |
sp|O27270|PSB_METTH | Proteasome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmB PE=3 SV=1 | 29 | 217 | 1.0E-14 |
sp|Q4JAA8|PSB2_SULAC | Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 | 29 | 218 | 2.0E-14 |
sp|A8MBW0|PSB1_CALMQ | Proteasome subunit beta 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB1 PE=3 SV=1 | 38 | 217 | 3.0E-14 |
sp|P28061|PSB_THEAC | Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 | 29 | 220 | 3.0E-14 |
sp|A5LHX3|PSB11_HUMAN | Proteasome subunit beta type-11 OS=Homo sapiens GN=PSMB11 PE=2 SV=1 | 29 | 212 | 4.0E-14 |
sp|Q9V0N9|PSB2_PYRAB | Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 | 29 | 212 | 4.0E-14 |
sp|Q980L4|PSB1_SULSO | Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB1 PE=3 SV=1 | 28 | 220 | 5.0E-14 |
sp|D0KRX1|PSB1_SULS9 | Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB1 PE=3 SV=1 | 28 | 220 | 5.0E-14 |
sp|C3N7K2|PSB2_SULIY | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB2 PE=3 SV=1 | 28 | 220 | 6.0E-14 |
sp|C3MY41|PSB2_SULIM | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB2 PE=3 SV=1 | 28 | 220 | 6.0E-14 |
sp|C3MRE5|PSB2_SULIL | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB2 PE=3 SV=1 | 28 | 220 | 6.0E-14 |
sp|C4KIR0|PSB2_SULIK | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB2 PE=3 SV=1 | 28 | 220 | 6.0E-14 |
sp|D2PDG6|PSB2_SULID | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB2 PE=3 SV=1 | 28 | 220 | 6.0E-14 |
sp|C3MZI0|PSB2_SULIA | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB2 PE=3 SV=1 | 28 | 220 | 6.0E-14 |
sp|C3NFX2|PSB1_SULIN | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB1 PE=3 SV=1 | 28 | 220 | 6.0E-14 |
sp|A2BN27|PSB2_HYPBU | Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 | 29 | 210 | 8.0E-14 |
sp|Q97AZ7|PSB_THEVO | Proteasome subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmB PE=3 SV=1 | 29 | 227 | 9.0E-14 |
sp|A5UM14|PSB_METS3 | Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 | 29 | 212 | 1.0E-13 |
sp|A3DN21|PSB1_STAMF | Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 | 27 | 219 | 2.0E-13 |
sp|A4YIE0|PSB1_METS5 | Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 | 29 | 218 | 2.0E-13 |
sp|C6A2V9|PSB1_THESM | Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 | 29 | 212 | 3.0E-13 |
sp|C5A2D5|PSB2_THEGJ | Proteasome subunit beta 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB2 PE=3 SV=1 | 25 | 217 | 4.0E-13 |
sp|Q5JDJ9|PSB1_THEKO | Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 | 29 | 212 | 4.0E-13 |
sp|C9Z4D0|PSB_STRSW | Proteasome subunit beta OS=Streptomyces scabiei (strain 87.22) GN=prcB PE=3 SV=1 | 25 | 201 | 4.0E-13 |
sp|Q9UXF3|PSB2_SULSO | Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 | 29 | 219 | 5.0E-13 |
sp|D0KTH0|PSB2_SULS9 | Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 | 29 | 219 | 5.0E-13 |
sp|B9LTS6|PSB_HALLT | Proteasome subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=psmB PE=3 SV=1 | 23 | 218 | 6.0E-13 |
sp|B8D683|PSB2_DESK1 | Proteasome subunit beta 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB2 PE=3 SV=1 | 30 | 208 | 6.0E-13 |
sp|A8AA46|PSB1_IGNH4 | Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 | 29 | 208 | 6.0E-13 |
sp|C3NE98|PSB1_SULIY | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 | 29 | 219 | 8.0E-13 |
sp|C3MVD5|PSB1_SULIM | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 | 29 | 219 | 8.0E-13 |
sp|C3MQ16|PSB1_SULIL | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 | 29 | 219 | 8.0E-13 |
sp|C4KHB0|PSB1_SULIK | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 | 29 | 219 | 8.0E-13 |
sp|D2PK63|PSB1_SULID | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 | 29 | 219 | 8.0E-13 |
sp|C3N5N4|PSB1_SULIA | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 | 29 | 219 | 8.0E-13 |
sp|C5A7L1|PSB1_THEGJ | Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 | 29 | 212 | 8.0E-13 |
sp|Q8BG41|PSB11_MOUSE | Proteasome subunit beta type-11 OS=Mus musculus GN=Psmb11 PE=1 SV=1 | 29 | 212 | 8.0E-13 |
sp|A8M8R5|PSB2_CALMQ | Proteasome subunit beta 2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB2 PE=3 SV=1 | 25 | 222 | 9.0E-13 |
sp|C3NHF1|PSB2_SULIN | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 | 29 | 219 | 1.0E-12 |
sp|B6YSW2|PSB1_THEON | Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 | 29 | 212 | 1.0E-12 |
sp|Q18GX3|PSB_HALWD | Proteasome subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmB PE=3 SV=1 | 25 | 214 | 1.0E-12 |
sp|P30655|PSB5_SCHPO | Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pts1 PE=3 SV=3 | 25 | 212 | 1.0E-12 |
sp|O73817|PSB3_ONCMY | Proteasome subunit beta type-3 OS=Oncorhynchus mykiss GN=psmb3 PE=2 SV=1 | 29 | 217 | 2.0E-12 |
sp|B8D673|PSB1_DESK1 | Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 | 24 | 212 | 2.0E-12 |
sp|Q9R1P1|PSB3_MOUSE | Proteasome subunit beta type-3 OS=Mus musculus GN=Psmb3 PE=1 SV=1 | 29 | 217 | 3.0E-12 |
sp|P40112|PSB3_RAT | Proteasome subunit beta type-3 OS=Rattus norvegicus GN=Psmb3 PE=1 SV=1 | 29 | 217 | 5.0E-12 |
sp|D2RUI0|PSB2_HALTV | Proteasome subunit beta 2 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB2 PE=3 SV=1 | 39 | 214 | 5.0E-12 |
sp|C6A3R1|PSB2_THESM | Proteasome subunit beta 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB2 PE=3 SV=1 | 25 | 217 | 6.0E-12 |
sp|D1A2S9|PSB1_THECD | Proteasome subunit beta 1 OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=prcB1 PE=3 SV=1 | 25 | 223 | 6.0E-12 |
sp|D3SSQ6|PSB_NATMM | Proteasome subunit beta OS=Natrialba magadii (strain ATCC 43099 / DSM 3394 / NCIMB 2190 / MS3) GN=psmB PE=3 SV=1 | 38 | 216 | 8.0E-12 |
sp|D2RQX3|PSB1_HALTV | Proteasome subunit beta 1 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB1 PE=3 SV=1 | 39 | 216 | 8.0E-12 |
sp|P33672|PSB3_BOVIN | Proteasome subunit beta type-3 OS=Bos taurus GN=PSMB3 PE=1 SV=3 | 29 | 217 | 1.0E-11 |
sp|P49720|PSB3_HUMAN | Proteasome subunit beta type-3 OS=Homo sapiens GN=PSMB3 PE=1 SV=2 | 29 | 217 | 2.0E-11 |
sp|Q7AKQ5|PSB_STRCO | Proteasome subunit beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prcB PE=1 SV=1 | 25 | 201 | 2.0E-11 |
sp|D2Q4H4|PSB_KRIFD | Proteasome subunit beta OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) GN=prcB PE=3 SV=1 | 25 | 201 | 4.0E-11 |
sp|Q828I8|PSB2_STRAW | Proteasome subunit beta 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prcB2 PE=3 SV=1 | 25 | 201 | 4.0E-11 |
sp|A2BN24|PSB1_HYPBU | Proteasome subunit beta 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB1 PE=3 SV=1 | 41 | 211 | 5.0E-11 |
sp|Q975U8|PSB1_SULTO | Proteasome subunit beta 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB1 PE=3 SV=1 | 28 | 210 | 6.0E-11 |
sp|Q5V1D5|PSB2_HALMA | Proteasome subunit beta 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB2 PE=3 SV=1 | 26 | 214 | 7.0E-11 |
sp|D1BS26|PSB_XYLCX | Proteasome subunit beta OS=Xylanimonas cellulosilytica (strain DSM 15894 / CECT 5975 / LMG 20990 / XIL07) GN=prcB PE=3 SV=1 | 30 | 201 | 2.0E-10 |
sp|A9A4A1|PSB1_NITMS | Proteasome subunit beta 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB1 PE=3 SV=1 | 29 | 216 | 2.0E-10 |
sp|Q4JAY3|PSB1_SULAC | Proteasome subunit beta 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB1 PE=3 SV=1 | 28 | 210 | 4.0E-10 |
sp|B1W306|PSB_STRGG | Proteasome subunit beta OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=prcB PE=3 SV=1 | 25 | 201 | 4.0E-10 |
sp|A0LU50|PSB_ACIC1 | Proteasome subunit beta OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=prcB PE=3 SV=1 | 22 | 201 | 6.0E-10 |
sp|Q9HR36|PSB_HALSA | Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmB PE=3 SV=2 | 29 | 212 | 6.0E-10 |
sp|B0R4C8|PSB_HALS3 | Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmB PE=3 SV=1 | 29 | 212 | 6.0E-10 |
sp|B6YXV3|PSB2_THEON | Proteasome subunit beta 2 OS=Thermococcus onnurineus (strain NA1) GN=psmB2 PE=3 SV=1 | 38 | 212 | 7.0E-10 |
sp|A4YJ04|PSB2_METS5 | Proteasome subunit beta 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB2 PE=3 SV=1 | 28 | 212 | 7.0E-10 |
sp|Q9IB83|PSB1B_CARAU | Proteasome subunit beta type-1-B OS=Carassius auratus GN=psmb1-B PE=2 SV=1 | 29 | 212 | 2.0E-09 |
sp|Q9IB84|PSB1A_CARAU | Proteasome subunit beta type-1-A OS=Carassius auratus GN=psmb1-A PE=2 SV=1 | 29 | 212 | 2.0E-09 |
sp|Q5JHL8|PSB2_THEKO | Proteasome subunit beta 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB2 PE=3 SV=1 | 25 | 212 | 3.0E-09 |
sp|P42742|PSB1_ARATH | Proteasome subunit beta type-1 OS=Arabidopsis thaliana GN=PBF1 PE=1 SV=2 | 27 | 217 | 3.0E-09 |
sp|O57983|PSB1_PYRHO | Proteasome subunit beta 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB1 PE=3 SV=1 | 29 | 217 | 6.0E-09 |
sp|A9WSI1|PSB_RENSM | Proteasome subunit beta OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=prcB PE=3 SV=1 | 30 | 204 | 6.0E-09 |
sp|Q9V247|PSB1_PYRAB | Proteasome subunit beta 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB1 PE=3 SV=1 | 29 | 212 | 6.0E-09 |
sp|Q2J9Q3|PSB_FRASC | Proteasome subunit beta OS=Frankia sp. (strain CcI3) GN=prcB PE=3 SV=2 | 25 | 216 | 9.0E-09 |
sp|O82531|PSB1_PETHY | Proteasome subunit beta type-1 OS=Petunia hybrida GN=PBF1 PE=2 SV=1 | 27 | 216 | 1.0E-08 |
sp|P20618|PSB1_HUMAN | Proteasome subunit beta type-1 OS=Homo sapiens GN=PSMB1 PE=1 SV=2 | 29 | 212 | 1.0E-08 |
sp|Q0RLT7|PSB_FRAAA | Proteasome subunit beta OS=Frankia alni (strain ACN14a) GN=prcB PE=3 SV=2 | 25 | 201 | 2.0E-08 |
sp|Q8U4C9|PSB1_PYRFU | Proteasome subunit beta 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB1 PE=3 SV=1 | 25 | 212 | 2.0E-08 |
sp|D1BHT9|PSB_SANKS | Proteasome subunit beta OS=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) GN=prcB PE=3 SV=1 | 29 | 201 | 3.0E-08 |
sp|Q82JE3|PSB1_STRAW | Proteasome subunit beta 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prcB1 PE=3 SV=1 | 8 | 223 | 3.0E-08 |
sp|C7PVV2|PSB_CATAD | Proteasome subunit beta OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=prcB PE=3 SV=1 | 29 | 223 | 3.0E-08 |
sp|D0LDT1|PSB_GORB4 | Proteasome subunit beta OS=Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / JCM 3198 / NCTC 10667) GN=prcB PE=3 SV=1 | 20 | 206 | 5.0E-08 |
sp|Q5V4S6|PSB1_HALMA | Proteasome subunit beta 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB1 PE=3 SV=1 | 39 | 218 | 6.0E-08 |
sp|A6W970|PSB_KINRD | Proteasome subunit beta OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=prcB PE=3 SV=1 | 30 | 225 | 6.0E-08 |
sp|A0RU86|PSB1_CENSY | Proteasome subunit beta 1 OS=Cenarchaeum symbiosum (strain A) GN=psmB1 PE=3 SV=1 | 29 | 213 | 9.0E-08 |
sp|Q86A21|PSB1_DICDI | Proteasome subunit beta type-1 OS=Dictyostelium discoideum GN=psmB1 PE=3 SV=1 | 26 | 212 | 1.0E-07 |
sp|Q3IPX1|PSB_NATPD | Proteasome subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=psmB PE=3 SV=1 | 39 | 211 | 1.0E-07 |
sp|C7R403|PSB_JONDD | Proteasome subunit beta OS=Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) GN=prcB PE=3 SV=1 | 29 | 189 | 1.0E-07 |
sp|C7NQ99|PSB_HALUD | Proteasome subunit beta OS=Halorhabdus utahensis (strain DSM 12940 / JCM 11049 / AX-2) GN=psmB PE=3 SV=1 | 38 | 214 | 2.0E-07 |
sp|B1MAI2|PSB_MYCA9 | Proteasome subunit beta OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=prcB PE=3 SV=1 | 24 | 209 | 2.0E-07 |
sp|Q5YUX2|PSB_NOCFA | Proteasome subunit beta OS=Nocardia farcinica (strain IFM 10152) GN=prcB PE=3 SV=1 | 29 | 201 | 3.0E-07 |
sp|A1SK13|PSB_NOCSJ | Proteasome subunit beta OS=Nocardioides sp. (strain BAA-499 / JS614) GN=prcB PE=3 SV=1 | 29 | 223 | 3.0E-07 |
sp|D2ATV1|PSB_STRRD | Proteasome subunit beta OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) GN=prcB PE=3 SV=1 | 30 | 201 | 5.0E-07 |
sp|Q9U794|PSB1_TRYBB | Proteasome subunit beta type-1 OS=Trypanosoma brucei brucei PE=2 SV=1 | 29 | 218 | 6.0E-07 |
sp|A4X3P0|PSB1_SALTO | Proteasome subunit beta 1 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=prcB1 PE=3 SV=1 | 24 | 216 | 9.0E-07 |
sp|O23714|PSB2A_ARATH | Proteasome subunit beta type-2-A OS=Arabidopsis thaliana GN=PBD1 PE=1 SV=1 | 42 | 191 | 9.0E-07 |
sp|O24633|PSB2B_ARATH | Proteasome subunit beta type-2-B OS=Arabidopsis thaliana GN=PBD2 PE=1 SV=1 | 42 | 191 | 9.0E-07 |
sp|P52427|PSA4_SPIOL | Proteasome subunit alpha type-4 OS=Spinacia oleracea GN=PAC1 PE=2 SV=1 | 4 | 193 | 1.0E-06 |
sp|Q8X077|PSA2_NEUCR | Probable proteasome subunit alpha type-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pca-2 PE=3 SV=1 | 3 | 194 | 1.0E-06 |
sp|Q9XI05|PSB3A_ARATH | Proteasome subunit beta type-3-A OS=Arabidopsis thaliana GN=PBC1 PE=1 SV=2 | 29 | 200 | 1.0E-06 |
sp|O82530|PSA4_PETHY | Proteasome subunit alpha type-4 OS=Petunia hybrida GN=PAC1 PE=2 SV=1 | 4 | 159 | 2.0E-06 |
sp|A8LH54|PSB_FRASN | Proteasome subunit beta OS=Frankia sp. (strain EAN1pec) GN=prcB PE=3 SV=1 | 29 | 201 | 2.0E-06 |
sp|P22141|PSB4_YEAST | Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE1 PE=1 SV=2 | 32 | 194 | 2.0E-06 |
sp|P23724|PSB6_YEAST | Proteasome subunit beta type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE7 PE=1 SV=1 | 18 | 218 | 3.0E-06 |
sp|O24733|PSA_THEK1 | Proteasome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=psmA PE=3 SV=1 | 8 | 211 | 4.0E-06 |
sp|Q5JIU9|PSA_THEKO | Proteasome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmA PE=3 SV=1 | 8 | 211 | 4.0E-06 |
sp|C5BVA2|PSB_BEUC1 | Proteasome subunit beta OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=prcB PE=3 SV=1 | 9 | 180 | 7.0E-06 |
sp|A1R6Q7|PSB_ARTAT | Proteasome subunit beta OS=Arthrobacter aurescens (strain TC1) GN=prcB PE=3 SV=2 | 30 | 201 | 1.0E-05 |
GO Term | Description | Terminal node |
---|---|---|
GO:0051603 | proteolysis involved in protein catabolic process | Yes |
GO:0005839 | proteasome core complex | Yes |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0032991 | protein-containing complex | No |
GO:0071704 | organic substance metabolic process | No |
GO:0008152 | metabolic process | No |
GO:0006508 | proteolysis | No |
GO:0019538 | protein metabolic process | No |
GO:0043170 | macromolecule metabolic process | No |
GO:0044238 | primary metabolic process | No |
GO:0005575 | cellular_component | No |
GO:0008150 | biological_process | No |
GO:0006807 | nitrogen compound metabolic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 53 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|3812 MEFSHSGVLNEDGIHVDMEHLKKGEVNLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDTIWCCRS GSAADTQAVADIVQYQLGLFAMHSGKPPMTQTAASIFQELCYSNKDRLSAGLIIAGWDERFGGQVYSIPLGGSLH KQAYAIGGSGSTYIYGYCDANWREGMDEADAVNFVKGALREAIKWDGSSGGVIRMVVLTKKGADRHLYLPDTDYK VRHE* |
Coding | >Hirsu2|3812 ATGGAGTTTAGCCACAGCGGCGTCTTGAACGAAGATGGCATCCATGTCGACATGGAGCACCTGAAGAAGGGCGAG GTCAACCTGGGCACGTCGATCATGGCCGTCACCTTCAAGGACGGCGTCATCCTCGGTGCCGACTCGCGGACGACG ACGGGGGCCTACATCGCCAACCGCGTGACGGACAAGCTGACGCGGGTGCACGACACCATCTGGTGCTGCCGGTCG GGCTCGGCCGCCGACACGCAGGCCGTGGCCGACATCGTGCAGTACCAGCTCGGGCTCTTTGCCATGCACAGCGGC AAGCCGCCGATGACGCAGACGGCCGCGTCGATATTCCAGGAGCTTTGCTACTCCAACAAGGACCGCCTGTCGGCC GGCCTGATCATCGCCGGCTGGGACGAGCGGTTCGGCGGCCAGGTCTACTCGATCCCCCTGGGCGGGTCGCTGCAC AAGCAGGCGTACGCCATCGGCGGCTCCGGATCGACGTACATCTACGGCTACTGCGACGCCAACTGGCGCGAGGGC ATGGACGAGGCCGACGCTGTCAACTTCGTCAAGGGCGCGCTCAGGGAGGCGATCAAGTGGGACGGCAGCTCGGGC GGCGTCATCCGCATGGTCGTGCTCACCAAGAAGGGCGCGGACCGGCACCTGTACCTGCCGGACACGGACTACAAG GTGCGCCACGAGTAG |
Transcript | >Hirsu2|3812 ATGGAGTTTAGCCACAGCGGCGTCTTGAACGAAGATGGCATCCATGTCGACATGGAGCACCTGAAGAAGGGCGAG GTCAACCTGGGCACGTCGATCATGGCCGTCACCTTCAAGGACGGCGTCATCCTCGGTGCCGACTCGCGGACGACG ACGGGGGCCTACATCGCCAACCGCGTGACGGACAAGCTGACGCGGGTGCACGACACCATCTGGTGCTGCCGGTCG GGCTCGGCCGCCGACACGCAGGCCGTGGCCGACATCGTGCAGTACCAGCTCGGGCTCTTTGCCATGCACAGCGGC AAGCCGCCGATGACGCAGACGGCCGCGTCGATATTCCAGGAGCTTTGCTACTCCAACAAGGACCGCCTGTCGGCC GGCCTGATCATCGCCGGCTGGGACGAGCGGTTCGGCGGCCAGGTCTACTCGATCCCCCTGGGCGGGTCGCTGCAC AAGCAGGCGTACGCCATCGGCGGCTCCGGATCGACGTACATCTACGGCTACTGCGACGCCAACTGGCGCGAGGGC ATGGACGAGGCCGACGCTGTCAACTTCGTCAAGGGCGCGCTCAGGGAGGCGATCAAGTGGGACGGCAGCTCGGGC GGCGTCATCCGCATGGTCGTGCTCACCAAGAAGGGCGCGGACCGGCACCTGTACCTGCCGGACACGGACTACAAG GTGCGCCACGAGTAG |
Gene | >Hirsu2|3812 ATGGAGTTTAGCCACAGCGGCGTCTTGAACGAAGGTGAGAGAACGAGAGAGCGGGAGACGGAGACGGAGTCCGAA AGCAGAAGAGCTGACAGGCCCGGGACCAGATGGCATCCATGTCGACATGGAGCACCTGAAGAAGGGCGAGGTCAA GTAGGTACGCCGAGGCGCCGGACGAGCGAGCGACTGACGGGCGGAACCGCGACCAGCCTGGGCACGTCGATCATG GCCGTCACCTTCAAGGACGGCGTCATCCTCGGTATGCATCCTCCCCCCCCCCAATCGCCCAGGCGGTGAGCTTCT CGACGGCTGACGGGCTTCGACGCTGGCAAACAAAACAGGTGCCGACTCGCGGACGACGACGGGGGCCTACATCGC CAACCGCGTGACGGACAAGCTGACGCGGGTGCACGACACCATCTGGTGCTGCCGGTCGGGCTCGGCCGCCGACAC GCAGGCCGTGGCCGACATCGTGCAGTACCAGCTCGGGCTCTTTGCCATGCACAGCGGCAAGCCGCCGATGACGCA GACGGCCGCGTCGATATTCCAGGAGCTTTGCTACTCCAACAAGGACCGCCTGTCGTGCGTCTGCCCCCCCCCCCT CTCTCCTCCCTCCCTCTACTCTGGCTCTCTTCTTCTACTCCTCCCTCTGTCCTTCTACTCCTCCCTCTGTCCTTC TACTCTTGCCTCTCTCCCCCAAACTTCTCTTTTTCTTGCGCCCGAATCTGCCGGCCAGGAAGCAGAAAAGAAAAG AGACTGACGAGCGGCGGACGAGAACAACAGGGCCGGCCTGATCATCGCCGGCTGGGACGAGCGGTTCGGCGGCCA GGTCTACTCGATCCCCCTGGGCGGGTCGCTGCACAAGCAGGCGTACGCCATCGGCGGCTCCGGATCGACGTACAT CTACGGCTACTGCGACGCCAACTGGCGCGAGGGCATGGACGAGGCCGACGCTGTCAACTTCGTCAAGGGCGCGCT CAGGGAGGCGATCAAGTGGGACGGCAGCTCGGGCGGCGTCATCCGCATGGTCGTGCTCACCAAGAAGGGCGCGGA CCGGCACCTGTACCTGCCGGACACGGACTACAAGGTGCGCCACGAGTAG |