Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|381
Gene name
LocationContig_1073:205..1881
Strand-
Gene length (bp)1676
Transcript length (bp)1398
Coding sequence length (bp)1398
Protein length (aa) 466

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 1.0E-13 217 420

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05924|DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCR2 PE=1 SV=1 153 462 2.0E-47
sp|Q9FMK9|PPA29_ARATH Probable inactive purple acid phosphatase 29 OS=Arabidopsis thaliana GN=PAP29 PE=2 SV=1 205 456 3.0E-37
sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.05 PE=3 SV=1 50 462 7.0E-37
sp|Q84LR6|PPA14_ARATH Probable inactive purple acid phosphatase 14 OS=Arabidopsis thaliana GN=PAP14 PE=2 SV=1 210 456 6.0E-33
sp|Q9LU72|PPA28_ARATH Probable inactive purple acid phosphatase 28 OS=Arabidopsis thaliana GN=PAP28 PE=2 SV=1 192 456 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05924|DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCR2 PE=1 SV=1 153 462 2.0E-47
sp|Q9FMK9|PPA29_ARATH Probable inactive purple acid phosphatase 29 OS=Arabidopsis thaliana GN=PAP29 PE=2 SV=1 205 456 3.0E-37
sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.05 PE=3 SV=1 50 462 7.0E-37
sp|Q84LR6|PPA14_ARATH Probable inactive purple acid phosphatase 14 OS=Arabidopsis thaliana GN=PAP14 PE=2 SV=1 210 456 6.0E-33
sp|Q9LU72|PPA28_ARATH Probable inactive purple acid phosphatase 28 OS=Arabidopsis thaliana GN=PAP28 PE=2 SV=1 192 456 3.0E-30
sp|Q12212|SIA1_YEAST Protein SIA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIA1 PE=2 SV=1 131 438 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|381
MTRRIVRTLTQFCAAITFTLLLIFLLDRNYRVLPNAIHGYMPTHHPGLVVTDITIVTCSSVNIFSSCDLDPDVWH
RIDKELYLGRAWTSSAYVYVSRKHEEELTADDSVVMDVTVGRLDPGVQNQPDDAGKWESRPGGLWLKRSKKRKSS
DSKDVVTNIDVLFGDDAVEARDGWAIVGTPLLLNTGGPLLSVHLSAHRGIVKEPKKPKPRIPDNGRFKIMQIADL
HLSNGVGECREPTPDGYAGGKCEADPRTLDFVGRILDEEKPDFVVLSGDQVNGRTAPDAPTAIFKYALMLSKRKI
PHVGIFGNHDDEKTMSRARQMALMETLPYSLSAAGPAEVDGVGNYYVEILARGGSDHSALTIYLLDTHSYSPDER
KYPGYDWVKPSQIEWFKRTAAGLKKKHSEYTHRHMDMAFIHIPLTEYADWQLPRVGQWLEGVTAPMFNSGFRDAL
VEEGVVMVSAGQSSR*
Coding >Hirsu2|381
ATGACGCGACGAATCGTTCGCACCTTGACGCAGTTCTGCGCCGCCATCACCTTCACCCTCCTCCTCATCTTCCTC
CTCGACCGCAACTACCGCGTCCTCCCTAATGCCATCCACGGGTACATGCCCACTCACCACCCAGGGCTCGTCGTC
ACCGACATCACCATCGTCACCTGCTCCAGCGTCAACATCTTCTCCTCCTGCGACCTCGACCCCGACGTCTGGCAT
CGGATCGACAAGGAACTCTATCTCGGAAGGGCTTGGACTTCGAGCGCCTACGTCTACGTGAGCCGTAAGCATGAG
GAGGAACTGACGGCCGACGACAGCGTCGTCATGGACGTGACGGTGGGGCGGCTGGATCCCGGTGTCCAGAACCAG
CCGGATGACGCGGGAAAGTGGGAGTCCCGGCCGGGCGGCCTATGGCTGAAGCGGTCCAAGAAGAGGAAATCGAGC
GACTCCAAGGACGTCGTCACCAACATTGATGTCCTCTTCGGAGACGACGCGGTCGAGGCGCGAGATGGCTGGGCC
ATTGTCGGCACCCCCCTGCTCCTCAACACGGGCGGCCCGCTGCTCAGCGTCCACCTCAGCGCCCATCGGGGCATC
GTCAAGGAGCCCAAGAAGCCCAAGCCGAGAATCCCGGACAACGGGCGCTTCAAGATCATGCAGATTGCCGACCTT
CATCTGAGCAACGGCGTGGGCGAGTGTCGCGAGCCCACCCCGGACGGCTACGCCGGCGGCAAGTGCGAGGCGGAT
CCGCGCACGCTCGACTTTGTCGGCAGGATCCTCGACGAAGAGAAGCCCGACTTTGTGGTGCTGAGTGGCGATCAA
GTCAACGGCCGCACGGCCCCCGATGCGCCCACGGCCATCTTCAAGTATGCGCTGATGCTGAGCAAGCGCAAGATC
CCCCACGTCGGCATCTTCGGCAACCACGACGACGAGAAGACCATGTCCCGGGCCCGGCAGATGGCCCTGATGGAG
ACGCTGCCCTACTCCCTCTCCGCCGCCGGGCCGGCCGAGGTGGACGGCGTCGGCAACTACTACGTCGAGATACTG
GCGCGCGGCGGCTCGGACCACTCGGCGCTGACCATCTACCTGCTCGACACGCACTCGTACTCGCCCGACGAGAGG
AAGTACCCCGGCTACGACTGGGTCAAGCCCAGCCAGATCGAGTGGTTCAAGCGGACGGCGGCGGGCCTGAAGAAG
AAGCACAGCGAGTACACGCACCGGCACATGGACATGGCCTTCATCCACATCCCCCTGACCGAGTACGCCGACTGG
CAGCTCCCGCGCGTCGGACAGTGGCTGGAGGGCGTGACGGCGCCCATGTTCAACTCGGGCTTCCGCGACGCGCTC
GTGGAGGAGGGCGTCGTCATGGTCAGCGCCGGGCAAAGCAGCCGGTGA
Transcript >Hirsu2|381
ATGACGCGACGAATCGTTCGCACCTTGACGCAGTTCTGCGCCGCCATCACCTTCACCCTCCTCCTCATCTTCCTC
CTCGACCGCAACTACCGCGTCCTCCCTAATGCCATCCACGGGTACATGCCCACTCACCACCCAGGGCTCGTCGTC
ACCGACATCACCATCGTCACCTGCTCCAGCGTCAACATCTTCTCCTCCTGCGACCTCGACCCCGACGTCTGGCAT
CGGATCGACAAGGAACTCTATCTCGGAAGGGCTTGGACTTCGAGCGCCTACGTCTACGTGAGCCGTAAGCATGAG
GAGGAACTGACGGCCGACGACAGCGTCGTCATGGACGTGACGGTGGGGCGGCTGGATCCCGGTGTCCAGAACCAG
CCGGATGACGCGGGAAAGTGGGAGTCCCGGCCGGGCGGCCTATGGCTGAAGCGGTCCAAGAAGAGGAAATCGAGC
GACTCCAAGGACGTCGTCACCAACATTGATGTCCTCTTCGGAGACGACGCGGTCGAGGCGCGAGATGGCTGGGCC
ATTGTCGGCACCCCCCTGCTCCTCAACACGGGCGGCCCGCTGCTCAGCGTCCACCTCAGCGCCCATCGGGGCATC
GTCAAGGAGCCCAAGAAGCCCAAGCCGAGAATCCCGGACAACGGGCGCTTCAAGATCATGCAGATTGCCGACCTT
CATCTGAGCAACGGCGTGGGCGAGTGTCGCGAGCCCACCCCGGACGGCTACGCCGGCGGCAAGTGCGAGGCGGAT
CCGCGCACGCTCGACTTTGTCGGCAGGATCCTCGACGAAGAGAAGCCCGACTTTGTGGTGCTGAGTGGCGATCAA
GTCAACGGCCGCACGGCCCCCGATGCGCCCACGGCCATCTTCAAGTATGCGCTGATGCTGAGCAAGCGCAAGATC
CCCCACGTCGGCATCTTCGGCAACCACGACGACGAGAAGACCATGTCCCGGGCCCGGCAGATGGCCCTGATGGAG
ACGCTGCCCTACTCCCTCTCCGCCGCCGGGCCGGCCGAGGTGGACGGCGTCGGCAACTACTACGTCGAGATACTG
GCGCGCGGCGGCTCGGACCACTCGGCGCTGACCATCTACCTGCTCGACACGCACTCGTACTCGCCCGACGAGAGG
AAGTACCCCGGCTACGACTGGGTCAAGCCCAGCCAGATCGAGTGGTTCAAGCGGACGGCGGCGGGCCTGAAGAAG
AAGCACAGCGAGTACACGCACCGGCACATGGACATGGCCTTCATCCACATCCCCCTGACCGAGTACGCCGACTGG
CAGCTCCCGCGCGTCGGACAGTGGCTGGAGGGCGTGACGGCGCCCATGTTCAACTCGGGCTTCCGCGACGCGCTC
GTGGAGGAGGGCGTCGTCATGGTCAGCGCCGGGCAAAGCAGCCGGTGA
Gene >Hirsu2|381
ATGACGCGACGAATCGTGAGCTCCTTCTTCCCCTTGTCCAACGGCACCGGCCGGCTCGGTCAGCCAGTCCACGGA
CTGATCCGACCATGGCCACTAGGTTCGCACCTTGACGCAGTTCTGCGCCGCCATCACCTTCACCCTCCTCCTCAT
CTTCCTCCTCGACCGCAACTACCGCGTCCTCCCTAATGCCATCCACGGGTACATGCCCACTCACCACCCAGGGCT
CGTCGTCACCGACATCACCATCGTCACCTGCTCCAGCGTCAACATCTTCTCCTCCTGCGACCTCGACCCCGACGT
CTGGCATCGGATCGACAAGGAACTCTATCTCGGAAGGGCTTGGACTTCGAGCGCCTACGTCTACGTGAGCCGTAA
GCATGAGGAGGAACTGACGGCCGACGACAGCGTCGTCATGGACGTGACGGTGGGGCGGCTGGATCCCGGTGTCCA
GAACCAGCCGGATGACGCGGGAAAGTGGGAGTCCCGGCCGGGCGGCCTATGGCTGAAGCGGTCCAAGAAGAGGAA
ATCGAGCGACTCCAAGGACGTCGTCACCAACATTGATGTCCTCTTCGGAGACGACGCGGTCGAGGCGCGAGATGG
CTGGGCCATTGTCGGCACCCCCCTGCTCCTCAACACGGGCGGCCCGCTGCTCAGCGTCCACCTCAGCGCCCATCG
GGGCATCGTCAAGGAGCCCAAGAAGCCCAAGCCGAGAATCCCGGACAACGGGCGCTTCAAGATCATGCAGATTGC
CGACCTTCATCTGAGCAACGGCGTGGGCGAGTGTCGCGAGCCCACCCCGGACGGCTACGCCGGCGGCAAGTGCGA
GGCGGATCCGCGCACGCTCGACTTTGTCGGCAGGATCCTCGACGAAGAGAAGCCCGACTTTGTGGTGCTGAGTGG
CGATCAAGTCAACGGCCGCACGGCCCCCGATGCGCCCACGGTTCGACTCCTTGTTGTTGACTGTGCCGAGAATGT
CGCTGACGTATCGCTTGCCGCAGGCCATCTTCAAGTATGCGCTGATGCTGAGCAAGCGCAAGATCCCCCACGTCG
GCATCTTCGGCAACCACGACGACGAGAAGACCATGTCCCGGGCCCGGCAGATGGCCCTGATGGAGACGCTGCCCT
ACTCCCTCTCCGCCGCCGGGCCGGCCGAGGTGGACGGCGTCGGCAACTACTACGTCGAGATACTGGCGCGCGGCG
GCTCGGACCACTCGGCGCTGACCATCTACCTGCTCGACACGCACTCGTACTCGCCCGACGAGAGGAAGTACCCCG
GCTACGACTGGGTCAAGCCCAGCCAGATCGAGTGGTTCAAGCGGACGGCGGCGGGCCTGAAGAAGAAGCACAGCG
AGTACACGCACCGGCACATGGACATGGCCTTCATCCACATCCCCCTGACCGAGTACGCCGACTGGCAGCTCCCGC
GCGTCGGACAGTGGCTGGAGGGCGTGACGGCGCCCATGTTCAACTCGGGCTTCCGCGACGCGCTCGTGGAGGAGG
GCGTCGTCATGGTCAGCGCCGGGCAGTACGTCCCGCCCCGCGCCCCCCTCTTTCCCTATCACTCCCCCCTTTCGA
CGTCGTTGGCTTCACTAACGCCTCCGACAGCGACCACTGCAACGACTACTGCTCCCTCTCGCTCTCGGGCGACCC
GGACCCGAAGAAGAAGCAGCCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail