Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3805
Gene name
LocationContig_2011:2860..3985
Strand-
Gene length (bp)1125
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15159 PIG-Y Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y 5.6E-22 291 368

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C6Y4B7|YIDS_SCHPO Uncharacterized protein C227.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.19c PE=2 SV=1 291 369 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 295 317 22
2 337 359 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3805
MTSASALETSSAASSAERITLVFSVVHVTPNRSPRHMEEGNKSDNQNDESTTGSTSHRRAPSGSSLLSRLPFMRV
SAECRPCQEPDYEELSSPPPSAVPVTIQHHKTRRRRGSLRKVALLGRGGQRDKRDERLLTSHILQITESAPDNSA
YSGACVAGHDALGLKIVRQPQQSQDHSLPFQNTSMNPPQALSTMARGGSGSCTERDGERFHLYTSTTDEEDLLHM
SPAALPPRTSLSMSSGSESYFGTRGSTDLPRSFKQAKSPLSYSGIPTNPIPPADSDWDYSETEWWGWVVLTVTWF
VFVMGMGSCLDVWSWAWDVGKTPYAPPELEDDPTLPIVGYYPALIIMTGVMAWVWVVVAWVGMKYFRHAKISGD*
Coding >Hirsu2|3805
ATGACCTCGGCCAGTGCCCTCGAAACCTCGTCTGCGGCCTCCTCTGCGGAGCGGATCACTCTGGTCTTTTCTGTT
GTTCACGTGACGCCCAACCGATCTCCACGACACATGGAGGAAGGAAATAAGAGTGACAACCAGAATGACGAGTCT
ACGACGGGTTCTACGTCTCATCGACGAGCGCCCTCGGGCTCCAGTCTGCTTTCAAGGCTTCCCTTCATGAGAGTT
TCAGCTGAATGCAGGCCGTGTCAGGAACCCGACTACGAAGAATTATCTTCTCCCCCGCCCTCTGCCGTTCCCGTT
ACGATTCAACATCACAAAACGCGACGACGGAGAGGATCCCTCAGGAAGGTGGCCCTCCTTGGCCGGGGGGGCCAG
CGCGACAAAAGAGACGAAAGGCTCTTGACGTCGCACATCCTGCAGATAACGGAAAGCGCGCCAGATAATTCAGCA
TACAGCGGAGCATGCGTCGCCGGGCATGACGCCCTTGGCCTTAAGATCGTCAGGCAACCTCAGCAGTCGCAAGAT
CATTCCTTGCCATTCCAGAACACATCGATGAACCCACCTCAAGCGCTGTCAACGATGGCGAGGGGCGGCTCAGGG
TCCTGCACAGAAAGGGATGGAGAACGATTTCATTTGTACACGTCCACTACGGATGAGGAGGACCTGCTTCACATG
TCACCGGCCGCTTTGCCGCCACGAACGTCGCTGTCCATGTCCTCGGGATCTGAGTCCTACTTTGGGACACGCGGA
AGCACAGATCTCCCAAGATCGTTTAAGCAAGCAAAGTCGCCCTTGTCGTATAGCGGCATCCCAACGAATCCCATT
CCGCCAGCCGACTCGGACTGGGATTACTCAGAGACAGAGTGGTGGGGTTGGGTTGTGCTTACAGTTACATGGTTT
GTCTTCGTCATGGGGATGGGCTCCTGTCTCGACGTCTGGAGCTGGGCGTGGGACGTTGGCAAAACACCGTACGCG
CCGCCGGAGCTTGAAGACGACCCCACTCTGCCTATCGTCGGATATTATCCTGCGCTCATCATAATGACGGGAGTC
ATGGCTTGGGTCTGGGTAGTTGTGGCTTGGGTTGGTATGAAATACTTTCGGCACGCCAAAATCAGCGGTGATTGA
Transcript >Hirsu2|3805
ATGACCTCGGCCAGTGCCCTCGAAACCTCGTCTGCGGCCTCCTCTGCGGAGCGGATCACTCTGGTCTTTTCTGTT
GTTCACGTGACGCCCAACCGATCTCCACGACACATGGAGGAAGGAAATAAGAGTGACAACCAGAATGACGAGTCT
ACGACGGGTTCTACGTCTCATCGACGAGCGCCCTCGGGCTCCAGTCTGCTTTCAAGGCTTCCCTTCATGAGAGTT
TCAGCTGAATGCAGGCCGTGTCAGGAACCCGACTACGAAGAATTATCTTCTCCCCCGCCCTCTGCCGTTCCCGTT
ACGATTCAACATCACAAAACGCGACGACGGAGAGGATCCCTCAGGAAGGTGGCCCTCCTTGGCCGGGGGGGCCAG
CGCGACAAAAGAGACGAAAGGCTCTTGACGTCGCACATCCTGCAGATAACGGAAAGCGCGCCAGATAATTCAGCA
TACAGCGGAGCATGCGTCGCCGGGCATGACGCCCTTGGCCTTAAGATCGTCAGGCAACCTCAGCAGTCGCAAGAT
CATTCCTTGCCATTCCAGAACACATCGATGAACCCACCTCAAGCGCTGTCAACGATGGCGAGGGGCGGCTCAGGG
TCCTGCACAGAAAGGGATGGAGAACGATTTCATTTGTACACGTCCACTACGGATGAGGAGGACCTGCTTCACATG
TCACCGGCCGCTTTGCCGCCACGAACGTCGCTGTCCATGTCCTCGGGATCTGAGTCCTACTTTGGGACACGCGGA
AGCACAGATCTCCCAAGATCGTTTAAGCAAGCAAAGTCGCCCTTGTCGTATAGCGGCATCCCAACGAATCCCATT
CCGCCAGCCGACTCGGACTGGGATTACTCAGAGACAGAGTGGTGGGGTTGGGTTGTGCTTACAGTTACATGGTTT
GTCTTCGTCATGGGGATGGGCTCCTGTCTCGACGTCTGGAGCTGGGCGTGGGACGTTGGCAAAACACCGTACGCG
CCGCCGGAGCTTGAAGACGACCCCACTCTGCCTATCGTCGGATATTATCCTGCGCTCATCATAATGACGGGAGTC
ATGGCTTGGGTCTGGGTAGTTGTGGCTTGGGTTGGTATGAAATACTTTCGGCACGCCAAAATCAGCGGTGATTGA
Gene >Hirsu2|3805
ATGACCTCGGCCAGTGCCCTCGAAACCTCGTCTGCGGCCTCCTCTGCGGAGCGGATCACTCTGGTCTTTTCTGTT
GTTCACGTGACGCCCAACCGATCTCCACGACACATGGAGGAAGGAAATAAGAGTGACAACCAGAATGACGAGTCT
ACGACGGGTTCTACGTCTCATCGACGAGCGCCCTCGGGCTCCAGTCTGCTTTCAAGGCTTCCCTTCATGAGAGTT
TCAGCTGAATGCAGGCCGTGTCAGGAACCCGACTACGAAGAATTATCTTCTCCCCCGCCCTCTGCCGTTCCCGTT
ACGATTCAACATCACAAAACGCGACGACGGAGAGGATCCCTCAGGAAGGTGGCCCTCCTTGGCCGGGGGGGCCAG
CGCGACAAAAGAGACGAAAGGCTCTTGACGTCGCACATCCTGCAGATAACGGAAAGCGCGCCAGATAATTCAGCA
TACAGCGGAGCATGCGTCGCCGGGCATGACGCCCTTGGCCTTAAGATCGTCAGGCAACCTCAGCAGTCGCAAGAT
CATTCCTTGCCATTCCAGAACACATCGATGAACCCACCTCAAGCGCTGTCAACGATGGCGAGGGGCGGCTCAGGG
TCCTGCACAGAAAGGGATGGAGAACGATTTCATTTGTACACGTCCACTACGGATGAGGAGGACCTGCTTCACATG
TCACCGGCCGCTTTGCCGCCACGAACGTCGCTGTCCATGTCCTCGGGATCTGAGTCCTACTTTGGGACACGCGGA
AGCACAGATCTCCCAAGATCGTTTAAGCAAGCAAAGTCGCCCTTGTCGTATAGCGGCATCCCAACGAATCCCATT
CCGCCAGCCGACTCGGACTGGGATTACTCAGAGACAGAGTGGTGGGGTTGGGTTGTGCTTACAGTTACATGGTTT
GTCTTCGTCATGGGGATGGGCTCCTGTCTCGACGTCTGGAGCTGGGCGTGGGACGTTGGCAAAACACCGTACGCG
CCGCCGGAGCTTGAAGACGACCCCACTCTGCCTATCGTCGGATATTATCCTGCGCTCATCATAATGACGGGAGTC
ATGGCTTGGGTCTGGGTAGTTGTGGCTTGGGTTGGTATGAAATACTTTCGGCACGCCAAAATCAGCGGTGATTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail