Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3790
Gene name
LocationContig_2009:1166..2091
Strand-
Gene length (bp)925
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05891 Methyltransf_PK AdoMet dependent proline di-methyltransferase 6.3E-76 18 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13748|NTM1_SCHPO Alpha N-terminal protein methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tae1 PE=3 SV=1 22 237 1.0E-53
sp|P38340|NTM1_YEAST Alpha N-terminal protein methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAE1 PE=1 SV=1 10 237 2.0E-50
sp|Q5PP70|NTM1_ARATH Alpha N-terminal protein methyltransferase 1 OS=Arabidopsis thaliana GN=At5g44450 PE=2 SV=1 20 235 4.0E-41
sp|B1H2P7|NTM1A_XENTR N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Xenopus tropicalis GN=ntmt1 PE=2 SV=1 1 221 2.0E-40
sp|Q4KL94|NT1AA_XENLA N-terminal Xaa-Pro-Lys N-methyltransferase 1-A OS=Xenopus laevis GN=ntmt1-a PE=2 SV=1 20 221 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13748|NTM1_SCHPO Alpha N-terminal protein methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tae1 PE=3 SV=1 22 237 1.0E-53
sp|P38340|NTM1_YEAST Alpha N-terminal protein methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAE1 PE=1 SV=1 10 237 2.0E-50
sp|Q5PP70|NTM1_ARATH Alpha N-terminal protein methyltransferase 1 OS=Arabidopsis thaliana GN=At5g44450 PE=2 SV=1 20 235 4.0E-41
sp|B1H2P7|NTM1A_XENTR N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Xenopus tropicalis GN=ntmt1 PE=2 SV=1 1 221 2.0E-40
sp|Q4KL94|NT1AA_XENLA N-terminal Xaa-Pro-Lys N-methyltransferase 1-A OS=Xenopus laevis GN=ntmt1-a PE=2 SV=1 20 221 1.0E-39
sp|Q6NN40|NTM1_DROME Alpha N-terminal protein methyltransferase 1 OS=Drosophila melanogaster GN=Ntmt PE=1 SV=1 18 237 4.0E-39
sp|Q6NWX7|NTM1A_DANRE N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Danio rerio GN=ntmt1 PE=2 SV=1 18 221 5.0E-38
sp|Q4KLE6|NT1AB_XENLA N-terminal Xaa-Pro-Lys N-methyltransferase 1-B OS=Xenopus laevis GN=ntmt1-b PE=2 SV=1 20 221 8.0E-38
sp|Q8R2U4|NTM1A_MOUSE N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Mus musculus GN=Ntmt1 PE=1 SV=3 18 236 1.0E-36
sp|A2XMJ1|NTM1_ORYSI Alpha N-terminal protein methyltransferase 1 OS=Oryza sativa subsp. indica GN=OsI_13745 PE=3 SV=1 23 235 3.0E-36
sp|Q10CT5|NTM1_ORYSJ Alpha N-terminal protein methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os03g0780900 PE=2 SV=2 23 235 4.0E-36
sp|Q5BJX0|NTM1A_RAT N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Rattus norvegicus GN=Ntmt1 PE=2 SV=3 18 236 9.0E-36
sp|Q2T9N3|NTM1A_BOVIN N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Bos taurus GN=NTMT1 PE=2 SV=3 18 221 2.0E-35
sp|Q9BV86|NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens GN=NTMT1 PE=1 SV=3 18 236 2.0E-35
sp|Q9N4D9|NTM1_CAEEL Alpha N-terminal protein methyltransferase 1 OS=Caenorhabditis elegans GN=homt-1 PE=2 SV=2 22 237 2.0E-35
sp|A8WVR2|NTM1_CAEBR Alpha N-terminal protein methyltransferase 1 OS=Caenorhabditis briggsae GN=homt-1 PE=3 SV=1 22 237 3.0E-32
sp|D3ZVR1|NTM1B_RAT Alpha N-terminal protein methyltransferase 1B OS=Rattus norvegicus GN=Mettl11b PE=3 SV=1 23 236 3.0E-30
sp|B2RXM4|NTM1B_MOUSE Alpha N-terminal protein methyltransferase 1B OS=Mus musculus GN=Mettl11b PE=2 SV=1 23 236 3.0E-30
sp|Q55DH6|NTM1_DICDI Alpha N-terminal protein methyltransferase 1 OS=Dictyostelium discoideum GN=DDB_G0269658 PE=3 SV=1 18 236 3.0E-30
sp|Q5VVY1|NTM1B_HUMAN Alpha N-terminal protein methyltransferase 1B OS=Homo sapiens GN=METTL11B PE=1 SV=2 23 236 6.0E-29
sp|D2H163|NTM1A_AILME N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Ailuropoda melanoleuca GN=NTMT1 PE=3 SV=1 20 221 6.0E-29
sp|B8JM82|NTM1B_DANRE Alpha N-terminal protein methyltransferase 1B OS=Danio rerio GN=mettl11b PE=3 SV=2 20 236 1.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0006480 N-terminal protein amino acid methylation Yes
GO:0008168 methyltransferase activity Yes
GO:0031365 N-terminal protein amino acid modification No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0003824 catalytic activity No
GO:0006479 protein methylation No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0032259 methylation No
GO:0044260 cellular macromolecule metabolic process No
GO:0008213 protein alkylation No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043414 macromolecule methylation No
GO:0044237 cellular metabolic process No
GO:0036211 protein modification process No
GO:0043170 macromolecule metabolic process No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6612 0.483 0.0314 0.0345 0.2433 0.0145 0.0447 0.0942 0.2187 0.0106

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2554
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5963
Ophiocordyceps australis map64 (Brazil) OphauB2|1344
Ophiocordyceps camponoti-floridani Ophcf2|03900
Ophiocordyceps camponoti-rufipedis Ophun1|2660
Ophiocordyceps kimflemingae Ophio5|6736
Ophiocordyceps subramaniannii Hirsu2|3790 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3790
MSTQADESEPPDSLIDASAGREYWQHVSVNNDGMLGGIPSEAGFGSISRIDLQGSRTFLARLGVGLKQDRRTLAR
ALDGGAGIGRVTEGLLLNVAEQVDVVEPVAKFTDVLKGKAGVGEIFNVGLEEWRPRDGAEYDLIWTQWCLGHLTD
EQIVQFLGRCKPALKSDSGIVVIKENLSTSGVDVFDSTDSCVTREDAKFRSLFEKAEMQLVRTELQRGFPETATK
KLLPVRMYALKP*
Coding >Hirsu2|3790
ATGTCGACGCAGGCGGACGAATCGGAACCGCCAGACAGCTTGATCGACGCCAGCGCCGGCCGAGAATACTGGCAG
CATGTCAGCGTCAATAACGACGGCATGCTAGGCGGCATTCCCTCGGAAGCGGGCTTCGGCTCCATCTCCAGGATT
GACCTCCAGGGCTCGCGCACCTTCTTGGCTCGTCTGGGCGTCGGCCTCAAGCAAGACCGCCGCACGCTGGCCCGG
GCGCTCGACGGCGGAGCAGGCATAGGCAGGGTCACGGAAGGCCTGCTGCTGAACGTGGCCGAGCAGGTGGACGTG
GTCGAGCCCGTGGCCAAGTTCACCGACGTCCTCAAGGGCAAGGCCGGCGTCGGCGAGATCTTCAACGTCGGGCTC
GAGGAGTGGCGGCCCCGCGACGGGGCCGAGTACGACCTGATCTGGACGCAGTGGTGCCTGGGCCACCTGACCGAC
GAGCAGATCGTCCAGTTCCTCGGGCGGTGCAAGCCGGCGCTCAAGTCCGACTCCGGCATCGTCGTCATCAAGGAA
AACCTCAGCACAAGTGGCGTCGACGTCTTCGACTCCACCGACAGCTGCGTGACGAGGGAGGACGCCAAGTTTCGC
AGCCTCTTCGAAAAGGCCGAGATGCAGCTGGTCAGGACTGAGCTGCAGCGCGGGTTCCCGGAAACGGCCACGAAG
AAACTGCTGCCGGTCAGGATGTATGCTCTGAAGCCATGA
Transcript >Hirsu2|3790
ATGTCGACGCAGGCGGACGAATCGGAACCGCCAGACAGCTTGATCGACGCCAGCGCCGGCCGAGAATACTGGCAG
CATGTCAGCGTCAATAACGACGGCATGCTAGGCGGCATTCCCTCGGAAGCGGGCTTCGGCTCCATCTCCAGGATT
GACCTCCAGGGCTCGCGCACCTTCTTGGCTCGTCTGGGCGTCGGCCTCAAGCAAGACCGCCGCACGCTGGCCCGG
GCGCTCGACGGCGGAGCAGGCATAGGCAGGGTCACGGAAGGCCTGCTGCTGAACGTGGCCGAGCAGGTGGACGTG
GTCGAGCCCGTGGCCAAGTTCACCGACGTCCTCAAGGGCAAGGCCGGCGTCGGCGAGATCTTCAACGTCGGGCTC
GAGGAGTGGCGGCCCCGCGACGGGGCCGAGTACGACCTGATCTGGACGCAGTGGTGCCTGGGCCACCTGACCGAC
GAGCAGATCGTCCAGTTCCTCGGGCGGTGCAAGCCGGCGCTCAAGTCCGACTCCGGCATCGTCGTCATCAAGGAA
AACCTCAGCACAAGTGGCGTCGACGTCTTCGACTCCACCGACAGCTGCGTGACGAGGGAGGACGCCAAGTTTCGC
AGCCTCTTCGAAAAGGCCGAGATGCAGCTGGTCAGGACTGAGCTGCAGCGCGGGTTCCCGGAAACGGCCACGAAG
AAACTGCTGCCGGTCAGGATGTATGCTCTGAAGCCATGA
Gene >Hirsu2|3790
ATGTCGACGCAGGCGGACGAATCGGAACCGCCAGACAGCTTGATCGACGCCAGCGCCGGCCGAGAATACTGGCAG
CATGTCAGCGTCAATAACGACGGCATGCTAGGCGGCATTCCCTCGGAAGCGGGCTTCGGCTCCATCTCCAGGATT
GACCTCCAGGGCTCGCGCACCTTCTTGGCTCGTCTGGGCGTCGGCCTCAAGCAAGACCGCCGCACGCTGGCCCGG
GCGCTCGACGGCGGAGCAGGGTACGTTGGTCGAGACGCGTCGCTCAGCCTACTTTGGTGGCCTGGCTGACGACCG
AGCATCATCTCCTTGACCGCTCCTCGACCCCTCACAGCATAGGCAGGGTCACGGAAGGCCTGCTGCTGAACGTGG
CCGAGCAGGTGGACGTGGTCGAGCCCGTGGCCAAGTTCACCGACGTCCTCAAGGGCAAGGCCGGCGTCGGCGAGA
TCTTCAACGTCGGGCTCGAGGAGTGGCGGCCCCGCGACGGGGCCGAGTACGACCTGATCTGGACGCAGTGGTGCC
TGGGCCACCTGACCGACGAGCAGATCGTCCAGTTCCTCGGGCGGTGCAAGCCGGCGCTCAAGTCCGACTCCGGCA
TCGTCGTCATCAAGGAAAACCTCAGCACAAGTGGCGTCGACGTCTTCGACTCCACCGACAGCTGCGTGACGAGGT
GAGTGGGATTTCCATCTCGTCTTTTTTGCCTTGTGCTTCCCCATCAGAAGGCGTCTGAAATACGGGGCGGGGCGC
CAAGGCATGGGAGACGGCCAGGGCTGACGTGTGGTGGCGCAGGGAGGACGCCAAGTTTCGCAGCCTCTTCGAAAA
GGCCGAGATGCAGCTGGTCAGGACTGAGCTGCAGCGCGGGTTCCCGGAAACGGCCACGAAGAAACTGCTGCCGGT
CAGGATGTATGCTCTGAAGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail